DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompA and nyo

DIOPT Version :9

Sequence 1:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_651871.2 Gene:nyo / 43716 FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster


Alignment Length:587 Identity:144/587 - (24%)
Similarity:235/587 - (40%) Gaps:115/587 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   907 PITRCEESDNFKQIAARHKMRRHFVRRALIVPSLIQCERECIESRDFVCRSFNYRDSAASGYEDR 971
            |...||    ||:|:.:.......|.:.  :.::.:|...|:.| .:.|.|::|.|:.       
  Fly   291 PSKLCE----FKRISGKILKTVDSVYQD--INTIDECRDLCLNS-PYRCHSYDYNDTG------- 341

  Fly   972 DRDRDRDSPNCELSDRDSREL-DIHDPGTFDASNYDFYERSIGRSDGECMDVTQTCNEEGMEFTI 1035
                   ...|.||......| |:.|| ..|......||.|      .|.:|:..|....|...|
  Fly   342 -------DMVCRLSHHSRATLTDVMDP-YLDVPEAATYELS------ACYNVSIECRSGEMITKI 392

  Fly  1036 RTPEGFLGRIYTYGFYDRCFFRGNGGTVNVLRLSGPQGYPD--CGTQR--YGDTLTNIVVVQFSD 1096
            ||.:.|.|::|..|....|....|    |.|......||.|  |..::  ||..: |.:|:|..|
  Fly   393 RTSKLFDGKVYAKGAPKSCAVNVN----NSLEFDFRMGYNDLECNVRQSAYGRYM-NDIVIQHHD 452

  Fly  1097 NVQTSRDKRYNLTCIFRGPGEAVVSSGYIGAGSGSPIPIEYLPAENTLSSKVRL---SILYQ--- 1155
            .:.||.|....::|.:....:.|::...:|. :|.        .|::||.::.:   :::.:   
  Fly   453 MIVTSSDLGLAVSCQYDLTNKTVLNDVDLGV-TGE--------IESSLSEEITIDSPNVIMKITS 508

  Fly  1156 --GRPTTTIA-VGDPLTFRLEAQDGYNHVTDIFATNVVARDPYSGRSIQLIDRFGCPVDPFVFPE 1217
              |.....:| |||||..|.|..:. |...:||...:||.|......|.|||..|||.|.::...
  Fly   509 RDGSDMKRMAEVGDPLALRFEIVEP-NSPYEIFVRELVAMDGSDSAEITLIDANGCPTDQYIMGT 572

  Fly  1218 LDKL-RDGDTLEARFNAFKIPESNFLVFEATVRSCREGCQPAYC---PGPAGRQEP--SFGRRRR 1276
            :.|| ::...|.::|:|||.|.|..:.|.|.|..|...|:|..|   .|.:|..:.  |:||::|
  Fly   573 IQKLAQNRKVLLSQFDAFKFPSSEVVQFRALVTPCIPRCEPVICDSEDGASGELKSLVSYGRKKR 637

  Fly  1277 S-LNTTEIPEPEALALEGSSQLEASTLDE-VTVVNSTTVSATLGQVPLNETQLGEKTKETEEPEQ 1339
            | ||.|:..|   ..:....:.:...:|: :.::.|..::...|..|.:.|..........|   
  Fly   638 SVLNGTDGAE---FLISTRHRRDVGPVDDNILLMQSIQITDKFGFQPEDGTTTHGNDSGPHE--- 696

  Fly  1340 VREMIEVFETREEIEKESYPRKLVAPVETVCMTPAEYHGLITAIILLMILLFSITLVAGLGYRRY 1404
                                 |..|.|....:|....:|||.|..|.::...||..:        
  Fly   697 ---------------------KAYAGVAQDKLTCLNGYGLIMAGALFLLAQLSIFGI-------- 732

  Fly  1405 WKSI----SKNRLVDRHSPIHSLGHSHSSIRTHERFTEIGHMPNLNGGGGGAAAGT--GGGANQS 1463
            ||::    ||.|.:.:|.|..::.:...::.         :.|..|...|.:|:||  ||.|..:
  Fly   733 WKTVQRRTSKERYLYQHEPTPTITYGAPTML---------YGPPPNSSAGSSASGTSYGGSAKDT 788

  Fly  1464 AS 1465
            .|
  Fly   789 LS 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532
PAN_AP_HGF 244..>303 CDD:238532
PAN_AP_HGF 349..424 CDD:238532
PAN_AP_HGF 914..1011 CDD:238532 21/97 (22%)
ZP 1025..1264 CDD:214579 73/255 (29%)
nyoNP_651871.2 PAN_1 121..198 CDD:278453
PAN_AP_HGF 208..286 CDD:238532
PAN_1 295..374 CDD:278453 23/100 (23%)
ZP 382..618 CDD:214579 72/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.