DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompA and CG12592

DIOPT Version :9

Sequence 1:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_731474.1 Gene:CG12592 / 41263 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster


Alignment Length:358 Identity:73/358 - (20%)
Similarity:135/358 - (37%) Gaps:88/358 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KNGLGRVLYERLPNQQLQGYDDDVVRDTAPPFRVLEKCQDLCLRDRSGSNNLVRTCTSF-DFQPG 93
            ||  .|.|||.:.:...:..|.| ..|.|.|             ..|.:::.::..||| |...|
  Fly   207 KN--NRSLYEIVDSDDEEEQDQD-QSDAAKP-------------AESENHSEIKKSTSFMDQMSG 255

  Fly    94 SRITSFGGNSEYEESLCYLTSEQAGPEGIGSLMLVPNSVHFNEICLTSSRPERECPSRRYVFERH 158
            ::    |..|.||....|.|.:   |:..|.     |.....:....:.:.:::..:...:.:..
  Fly   256 AK----GNKSVYEIMDSYETED---PKEAGK-----NEESDKDKPAENGKSDKDKQAETEMSDED 308

  Fly   159 PRKKLKLPISDIKE--ITAANRSDCEDKCLNEFSFVCRSANFDSTMRSCTLSRFTRR-----THP 216
            ...::|.| |.||:  |:.|:    |:..|.|.:    |::.....:.....:.:||     ..|
  Fly   309 KPSEIKSP-STIKKSIISTAD----EEALLAELA----SSDLSHLEKMFNPLQKSRRQSLHVPSP 364

  Fly   217 ELMEDDP----NSDYLE--NTCLNAERRCDGLAVFVKEENKR-------LGGPFEVDIFNNMTLE 268
            ||...:|    .|:.:|  |....::...|.:|...:::|||       .|.|           |
  Fly   365 ELAAKNPKLRRRSERVEVGNDFCPSQSFVDMVAEKKRQKNKRKRLSKSLSGAP-----------E 418

  Fly   269 ECQTMCLRAEKYFCR--------SVEFDDQSKQCILSEE---DSISQKDDISISSSPTHHFYDLV 322
            :.:.|.::.|:...:        |:|.|::::...::||   |......::.|...||      .
  Fly   419 DLEEMEIKHERKRLKSSHGASTDSMEEDNENETMTVAEEHHSDGEVSNGEVPIEEKPT------T 477

  Fly   323 CLDNQRANDYPD--NSVTSHLFSSGRRPDTAFQ 353
            ..:...|::.|:  ||....|....:|...|.|
  Fly   478 SSEKPSASELPEEGNSAPPALKKDVKRLQAARQ 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532 19/93 (20%)
PAN_AP_HGF 244..>303 CDD:238532 14/76 (18%)
PAN_AP_HGF 349..424 CDD:238532 2/5 (40%)
PAN_AP_HGF 914..1011 CDD:238532
ZP 1025..1264 CDD:214579
CG12592NP_731474.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.