DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompA and cutl-18

DIOPT Version :9

Sequence 1:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_505875.2 Gene:cutl-18 / 179565 WormBaseID:WBGene00009830 Length:801 Species:Caenorhabditis elegans


Alignment Length:321 Identity:66/321 - (20%)
Similarity:109/321 - (33%) Gaps:107/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKGIHVLLTTLVVSLSLSKINGQTTCKN---GLGRVLYERLPNQQLQGYDDDVVRDTAPPFRVLE 65
            ::.:|.|....:|:....:|.|::...|   |||                           :.:|
 Worm   180 KEAVHCLNAFKMVAFDAIEIRGESRIFNGSDGLG---------------------------KCME 217

  Fly    66 KCQDLCLRDRSGSNNLVRTCTSFDFQPGSRITSFGGNSEYEESLCYLTSEQAGPEGIGSLMLVPN 130
            ||:| |  |....|.....|.|....|..::..| .|.||:                    ::.|
 Worm   218 KCKD-C--DVVMYNEGFSECYSVWNDPSGQLLDF-VNDEYQ--------------------ILTN 258

  Fly   131 SVHFNEICLTSSRPERECPSRR--YVFERHPRKKLKLPISDIKEITAANRSDCEDKCLNEFSFVC 193
            :..:.         ::.|.||.  |:...:|.:.||              |:|.:||  ..|..|
 Worm   259 ACSYQ---------KKTCNSRNSLYISYSNPDESLK--------------SECLEKC--TMSEEC 298

  Fly   194 RSANFDSTMRSCTLSRFTRRTHPELMEDDPNSDYLENTCLNAERRCDGLAVF------VKEENKR 252
            |.|.....|.:|.:|| .|...|.|         .:..|.:.....||.|:.      .|.||.:
 Worm   299 RFAYQSKDMNNCLISR-RRMALPML---------AQKICADVNDLSDGSAILFDELGGCKNENGQ 353

  Fly   253 LGGPFEVDIFNNMTLEECQTMCLRAEKYFCRSVEFDDQSKQCILSEEDSISQKDDISISSS 313
            |       |..::.|.:|..:|.......|.|:.: .:|:.|.|  .|...:.|:.:.:.|
 Worm   354 L-------ISKDLELHQCMQLCATHPTRSCESISY-TKSRDCYL--HDGAVETDNENTNCS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532 21/82 (26%)
PAN_AP_HGF 244..>303 CDD:238532 14/64 (22%)
PAN_AP_HGF 349..424 CDD:238532
PAN_AP_HGF 914..1011 CDD:238532
ZP 1025..1264 CDD:214579
cutl-18NP_505875.2 PAN_AP_HGF 105..177 CDD:238532
PAN_AP 187..258 CDD:214680 21/121 (17%)
ZP 474..719 CDD:214579
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.