DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompA and let-653

DIOPT Version :10

Sequence 1:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001021336.2 Gene:let-653 / 178120 WormBaseID:WBGene00002827 Length:812 Species:Caenorhabditis elegans


Alignment Length:37 Identity:13/37 - (35%)
Similarity:18/37 - (48%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRIA-NEKASKNITMRGNVPKSSKNTEEKYPVGPWLL 42
            :|:: ||||.....|...:.....:||  .||  |||
 Worm   132 VRLSENEKAEDYKIMEKVLTVYFLSTE--IPV--WLL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532
PAN_AP_HGF 244..>303 CDD:238532
PAN_AP_HGF 349..424 CDD:238532
PHA03247 <579..907 CDD:223021
PAN_AP_HGF 914..1011 CDD:238532
ZP 1025..1264 CDD:214579
let-653NP_001021336.2 PAN_AP_HGF 124..208 CDD:238532 13/37 (35%)
ZP <606..727 CDD:214579
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.