| Sequence 1: | NP_524831.2 | Gene: | nompA / 45587 | FlyBaseID: | FBgn0016047 | Length: | 1557 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001021336.2 | Gene: | let-653 / 178120 | WormBaseID: | WBGene00002827 | Length: | 812 | Species: | Caenorhabditis elegans |
| Alignment Length: | 37 | Identity: | 13/37 - (35%) |
|---|---|---|---|
| Similarity: | 18/37 - (48%) | Gaps: | 5/37 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 IRIA-NEKASKNITMRGNVPKSSKNTEEKYPVGPWLL 42 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| nompA | NP_524831.2 | PAN_AP_HGF | 150..231 | CDD:238532 | |
| PAN_AP_HGF | 244..>303 | CDD:238532 | |||
| PAN_AP_HGF | 349..424 | CDD:238532 | |||
| PHA03247 | <579..907 | CDD:223021 | |||
| PAN_AP_HGF | 914..1011 | CDD:238532 | |||
| ZP | 1025..1264 | CDD:214579 | |||
| let-653 | NP_001021336.2 | PAN_AP_HGF | 124..208 | CDD:238532 | 13/37 (35%) |
| ZP | <606..727 | CDD:214579 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||