DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and FAHD1

DIOPT Version :9

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001018114.2 Gene:FAHD1 / 81889 HGNCID:14169 Length:245 Species:Homo sapiens


Alignment Length:283 Identity:55/283 - (19%)
Similarity:85/283 - (30%) Gaps:98/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DYTDFYSSIHHAT-NVGIMFRGPDNALMPNWRHLPVGYHGRASSVVVSGTPIRRPLGQTFPDGAE 183
            :|.|....:..|. :..::|..|..|..|                  .|:||..|          
Human    23 NYADHVREMRSAVLSEPVLFLKPSTAYAP------------------EGSPILMP---------- 59

  Fly   184 KPVFGACKLLDFELEMAFFIGGKGNQLGEPIRVDEAWKNVFGFTLMNDWSARDIQKWEYVPLGPF 248
                ...:.|..|||:...:|.:...:.|...:|    .|.|:.|..|.:|||:|.         
Human    60 ----AYTRNLHHELELGVVMGKRCRAVPEAAAMD----YVGGYALCLDMTARDVQD--------- 107

  Fly   249 TAKNLGTTISPWVV--------PTAALKPFVLDNFPQEPEVLPYLRQNIPFNFDINLEVSLKPAD 305
            ..|..|.   ||.:        |.:|..|                ::.||....:.|.:.:....
Human   108 ECKKKGL---PWTLAKSFTASCPVSAFVP----------------KEKIPDPHKLKLWLKVNGEL 153

  Fly   306 QNEALISKSNFKHLYWTPLQQIAHHTVTGCNLRPGDLMASGTISGETPDSYGSLLELCWKGTK-- 368
            :.|...|...|...|      |..:......|..||::.:||..|..|......:|....|.:  
Human   154 RQEGETSSMIFSIPY------IISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLRQG 212

  Fly   369 -----------------TLELPG 374
                             :|||||
Human   213 LTLSPKLECSSAITAHCSLELPG 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 55/283 (19%)
FAA_hydrolase_N 17..115 CDD:286391
FAA_hydrolase 121..409 CDD:279845 55/282 (20%)
FAHD1NP_001018114.2 MhpD <16..209 CDD:223257 49/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.