DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and Fahd2a

DIOPT Version :9

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_083905.1 Gene:Fahd2a / 68126 MGIID:1915376 Length:313 Species:Mus musculus


Alignment Length:391 Identity:90/391 - (23%)
Similarity:127/391 - (32%) Gaps:155/391 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QVQK------------SLQAETLNE-LMGL---------DFEAWDVVRSQTQKLLTKGSELDHNV 97
            ||||            ..||..|.| .:||         |..|:|....:|.....:..|...:|
Mouse    15 QVQKRPCQPSRNMRLVQFQAPHLEEPHLGLESGVGGGVVDLNAFDSTLPKTMVQFLEQGETTLSV 79

  Fly    98 DLKAVS----IVPQSEIKLHLPAQIGD--------YTDFYSSIHHATNVGIMFRGPDNALMPNWR 150
            ..:|::    ::|:|::....|....|        |.|      |...        .|..:|.  
Mouse    80 ARRALATQLPVIPRSQVTFLAPVTRPDKVICVGLNYAD------HCQE--------QNVRVPK-- 128

  Fly   151 HLPVGYHGRASSVVVSGTPIRRPLGQTFPDGAEKPVFGACKLLDFELEMAFFIGGKGNQLGEPIR 215
             .|:.:...:||:|.....|..|     |:..|         :|:|:|||..||.||..    |:
Mouse   129 -SPIIFSKFSSSIVGPYDEIILP-----PESKE---------VDWEVEMAVVIGKKGKH----IK 174

  Fly   216 VDEAWKNVFGFTLMNDWSARDIQ-----KW-------EYVPLGPFTAKNLGTTISPWVVPTAALK 268
            ..:...:|.|||:.:|.||||.|     :|       .:.|||                |....|
Mouse   175 ATDVMAHVAGFTVAHDVSARDWQMRNGKQWLLGKTFDTFCPLG----------------PALVTK 223

  Fly   269 PFVLDNFPQEPEVLPYLRQNIPFNFDINLEVSLKPADQNEALISKSNFKHLYWTPLQQIA--HHT 331
            ..:.|                |.|..|...|       |..::..||...:.:.....||  ...
Mouse   224 DTIAD----------------PHNLKICCRV-------NGEVVQSSNTNQMVFKTEYLIAWVSQF 265

  Fly   332 VTGCNLRPGDLMASGTISGETPDSYGSLLELCWKGTKTLELPGGKTRK---FLQDFDEVIIRGHC 393
            ||   |.||||:.:||..|.                       |..||   ||:..|||    .|
Mouse   266 VT---LYPGDLLLTGTPPGV-----------------------GMFRKPPVFLKKGDEV----QC 300

  Fly   394 E 394
            |
Mouse   301 E 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 90/391 (23%)
FAA_hydrolase_N 17..115 CDD:286391 19/85 (22%)
FAA_hydrolase 121..409 CDD:279845 69/291 (24%)
Fahd2aNP_083905.1 MhpD 51..313 CDD:223257 80/355 (23%)
FAA_hydrolase 109..312 CDD:279845 69/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.