Sequence 1: | NP_524830.2 | Gene: | Faa / 45577 | FlyBaseID: | FBgn0016013 | Length: | 417 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018564.1 | Gene: | fahd1 / 553762 | ZFINID: | ZDB-GENE-050522-448 | Length: | 219 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 44/198 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 PVGYHGRASSVVVSGTPIRRPLGQTFPDGAEKPVFGACKLLDFELEMAFFIGGKGNQLGEPIRVD 217
Fly 218 EAWKNVFGFTLMNDWSARDIQKWEYVPLGPFTAKNLGTTISPWVVPTAALKPFVLDNFPQEPEVL 282
Fly 283 PYLRQNIPFNFDINLEVSLKPADQNEALISKSNFKHLYWTPLQQIAHHTVTGCNLRPGDLMASGT 347
Fly 348 ISG 350 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Faa | NP_524830.2 | PLN02856 | 1..414 | CDD:215461 | 47/198 (24%) |
FAA_hydrolase_N | 17..115 | CDD:286391 | |||
FAA_hydrolase | 121..409 | CDD:279845 | 47/198 (24%) | ||
fahd1 | NP_001018564.1 | MhpD | <14..206 | CDD:223257 | 47/198 (24%) |
FAA_hydrolase | 17..209 | CDD:279845 | 47/198 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0179 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |