DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and fahd1

DIOPT Version :9

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001018564.1 Gene:fahd1 / 553762 ZFINID:ZDB-GENE-050522-448 Length:219 Species:Danio rerio


Alignment Length:198 Identity:47/198 - (23%)
Similarity:76/198 - (38%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PVGYHGRASSVVVSGTPIRRPLGQTFPDGAEKPVFGACKLLDFELEMAFFIGGKGNQLGEPIRVD 217
            ||.:....|:.:..|:||..|...:              .|..|:|:...| |||   |..|...
Zfish    38 PVLFLKPPSAYIKKGSPILVPFYSS--------------NLHHEVELGVVI-GKG---GTAIPQA 84

  Fly   218 EAWKNVFGFTLMNDWSARDIQKWEYVPLGPFTAKNLGTTISPWVVPTAALKPFVLDNFPQEPEVL 282
            .|.::|.|:.|..|.:|||:|.         ..|:.|.   ||.:..|......:.:|      :
Zfish    85 SAMEHVAGYVLCLDMTARDVQD---------ECKSKGL---PWTLAKAFNTSCPISDF------I 131

  Fly   283 PYLRQNIPFNFDINLEVSLKPADQNEALISKSNFKHLYWTPLQQIAHHTVTGCNLRPGDLMASGT 347
            |  ::.||....|||.:.:....:.....|:..|...|      :.::.....:|..|||:.:||
Zfish   132 P--KEKIPDPGSINLWLKVNNVQKQNGSTSQMIFSIPY------LINYISEIISLEEGDLILTGT 188

  Fly   348 ISG 350
            ..|
Zfish   189 PKG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 47/198 (24%)
FAA_hydrolase_N 17..115 CDD:286391
FAA_hydrolase 121..409 CDD:279845 47/198 (24%)
fahd1NP_001018564.1 MhpD <14..206 CDD:223257 47/198 (24%)
FAA_hydrolase 17..209 CDD:279845 47/198 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.