DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and FAHD2A

DIOPT Version :9

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_011509584.1 Gene:FAHD2A / 51011 HGNCID:24252 Length:339 Species:Homo sapiens


Alignment Length:365 Identity:84/365 - (23%)
Similarity:123/365 - (33%) Gaps:120/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLKAVSQLFPFQVQKSLQAETLNELMGLDFEAWDVVRSQTQKLLTKGSELDHNVDLKAVS----I 104
            |::.|....|..|...|..||.|....::..|:|....:|.....:..|...:|..:|::    :
Human    26 DMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPV 90

  Fly   105 VPQSEIKLHLPAQIGD--------YTDFYSSIHHATNVGIMFRGPDNALMPNWRHLPVGYHGRAS 161
            :|:||:....|....|        |.|      |...        .|..:|.   .|:.:...||
Human    91 LPRSEVTFLAPVTRPDKVVCVGMNYVD------HCKE--------QNVPVPK---EPIIFSKFAS 138

  Fly   162 SVVVSGTPIRRPLGQTFPDGAEKPVFGACKLLDFELEMAFFIGGKGNQLGEPIRVDEAWKNVFGF 226
            |:|.....:..|     |...|         :|:|:|:|..||.||..    |:..:|..:|.||
Human   139 SIVGPYDEVVLP-----PQSQE---------VDWEVELAVVIGKKGKH----IKATDAMAHVAGF 185

  Fly   227 TLMNDWSARDIQ------KW-------EYVPLGPFTAKNLGTTISPWVVPTAALKPFVLDNFPQE 278
            |:.:|.||||.|      :|       .:.|||                |....|..|.|     
Human   186 TVAHDVSARDWQMRRNGKQWLLGKTFDTFCPLG----------------PALVTKDSVAD----- 229

  Fly   279 PEVLPYLRQNIPFNFDINLEVSLKPADQNEALISKSNFKHLYWTPLQQIA--HHTVTGCNLRPGD 341
                       |.|..|...|       |..::...|...:.:.....||  ...||   ..|||
Human   230 -----------PHNLKICCRV-------NGEVVQSGNTNQMVFKTEDLIAWVSQFVT---FYPGD 273

  Fly   342 LMASGTISG--------------ETPDSYGSLLELC--WK 365
            ::.:||..|              |.|||....|.:|  ||
Human   274 VILTGTPPGVGVFRKPPVFLKVSEGPDSTDGKLWVCTLWK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 84/365 (23%)
FAA_hydrolase_N 17..115 CDD:286391 17/74 (23%)
FAA_hydrolase 121..409 CDD:279845 65/276 (24%)
FAHD2AXP_011509584.1 MhpD 51..284 CDD:223257 68/309 (22%)
FAA_hydrolase 109..294 CDD:279845 57/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.