DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and Fahd1

DIOPT Version :9

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001020162.1 Gene:Fahd1 / 302980 RGDID:1304560 Length:221 Species:Rattus norvegicus


Alignment Length:234 Identity:47/234 - (20%)
Similarity:74/234 - (31%) Gaps:83/234 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IMFRGPDNALMPNWRHLPVGYHGRASSVVVSGTPIRRPLGQTFPDGAEKPVFGACKLLDFELEMA 200
            ::|..|..|..|                  .|:|:..|              ..|:.|..|:|:.
  Rat    40 VLFLKPSTAYAP------------------EGSPVLMP--------------AYCRNLHHEVELG 72

  Fly   201 FFIGGKGNQLGEPIRVDEAWKNVFGFTLMNDWSARDIQKWEYVPLGPFTAKNLGTTISPWVV--- 262
            ..:|.:|..:.|...:|    .|.|:.|..|.:|||:|.         ..|..|.   ||.:   
  Rat    73 VLLGRRGEAVPEAAAMD----YVAGYALCLDMTARDVQD---------ECKKKGL---PWTLAKS 121

  Fly   263 -----PTAALKPFVLDNFPQEPEVLPYLRQNIPFNFDINLEVSLKPADQNEALISKSNFKHLYWT 322
                 |.:|..|                ::.||....:.|.:.:....:.|...|...|...|  
  Rat   122 FTSSCPVSAFVP----------------KEKIPDPHALRLWLKVNGELRQEGKTSSMIFSIPY-- 168

  Fly   323 PLQQIAHHTVTGCNLRPGDLMASGTISGETPDSYGSLLE 361
                |..:......|..|||:.:|     ||...|::.|
  Rat   169 ----IISYVSKIITLEEGDLILTG-----TPKGVGAVKE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 47/234 (20%)
FAA_hydrolase_N 17..115 CDD:286391
FAA_hydrolase 121..409 CDD:279845 47/234 (20%)
Fahd1NP_001020162.1 MhpD <16..220 CDD:223257 47/234 (20%)
FAA_hydrolase 18..216 CDD:279845 47/234 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0179
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.