DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Faa and Faa

DIOPT Version :10

Sequence 1:NP_524830.2 Gene:Faa / 45577 FlyBaseID:FBgn0016013 Length:417 Species:Drosophila melanogaster
Sequence 2:XP_315893.3 Gene:Faa / 1276533 VectorBaseID:AGAMI1_001002 Length:416 Species:Anopheles gambiae


Alignment Length:74 Identity:16/74 - (21%)
Similarity:21/74 - (28%) Gaps:19/74 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 NRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGRYTTPA 372
            |||.....|.|..|...:             ..:|........||.|.....:...|:|.     
Mosquito    21 NRPNYGGSGYGASYGDVV-------------KAAETAEAQASALTNAAGAAASAAKLDGA----- 67

  Fly   373 FDWSCLGSY 381
             ||:.|..|
Mosquito    68 -DWNSLNRY 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FaaNP_524830.2 PLN02856 1..414 CDD:215461 16/74 (22%)
FaaXP_315893.3 fum_ac_acetase 2..412 CDD:162276 16/74 (22%)

Return to query results.
Submit another query.