DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4F2

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:417 Identity:110/417 - (26%)
Similarity:199/417 - (47%) Gaps:41/417 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK---TAAD 166
            ||:.::..|...|....|.||...|..|||.|..    |:....:|:..|...:..:|   .|::
Human   124 FYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASE 184

  Fly   167 RGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAITEHRYGNML---DIFLF 226
            ....|::.:.::..|.|.:..|.|..:.:....| :|:::  :...|:...|:..:|   | ||:
Human   185 GSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVSKRHHEILLHID-FLY 247

  Fly   227 GFPKLSRRLRLKLNIQEAEDFYTKIVRET--------ID--YRLRTKEKRNDFMDSLIEMYKNEQ 281
            ......:|.|....:  ..||...:::|.        :|  .:.:.|.|..||:|.|:       
Human   248 YLTPDGQRFRRACRL--VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL------- 303

  Fly   282 SGNSEDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNK 343
            ....|||  |:..::.|:|..|...|.:|:::.:.:.||.||::.:.|::.|:|:..:. .:..|
Human   304 LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPK 368

  Fly   344 EFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPD 408
            |..::.:..:.:|...:.|:||.:|.:..::|....|....|.: .|.||.|.:|...|.|::|.
Human   369 EIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGR-VIPKGIICLISVFGTHHNPA 432

  Fly   409 IYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPET 473
            ::|:||::.|.||..|.|..|....::||..|||||||..|.|.:..|.||..:  .:|.|.|:.
Human   433 VWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTL--LRFRVLPDH 495

  Fly   474 QIPMKIVVKNILISAENGIHLKVEKLA 500
            ..|.:  ...:::.||.|:.|:||.|:
Human   496 TEPRR--KPELVLRAEGGLWLRVEPLS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 103/393 (26%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724
p450 52..515 CDD:365848 106/410 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.