DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and DIT2

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_010690.1 Gene:DIT2 / 852011 SGDID:S000002810 Length:489 Species:Saccharomyces cerevisiae


Alignment Length:481 Identity:109/481 - (22%)
Similarity:188/481 - (39%) Gaps:100/481 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSA------ 115
            |.|.:.....|....|||......:|:..|.|.:: .||.:.|...|   |:...|.||      
Yeast    56 DLYIRESMEKYGAVKFFFGSRWNILVSRSEYLAQI-FKDEDTFAKSG---NQKKIPYSALAAYTG 116

  Fly   116 -TLFSIEGQKWRHLRHKLT---------PTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQV 170
             .:.|..|..||:.|:.:|         |.|.:.|   :...::|     :::...:|:...|  
Yeast   117 DNVISAYGAVWRNYRNAVTNGLQHFDDAPIFKNAK---ILCTLIK-----NRLLEGQTSIPMG-- 171

  Fly   171 LEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEF----VSIGKRAITEHRYGNMLDIFLFGFPKL 231
                .|..|...|.|...|.|.:..:|...|..|    :.|.|:         :...|...||.|
Yeast   172 ----PLSQRMALDNISQVALGFDFGALTHEKNAFHEHLIRIKKQ---------IFHPFFLTFPFL 223

  Fly   232 SRRLRLKLNIQEAEDFYTKIV--RETIDYRLRTKEKRNDFMDSLIEMYKNEQS---------GNS 285
            .     .|.|...:..:..:|  ||.:..|::         |.|:..||.||:         .::
Yeast   224 D-----VLPIPSRKKAFKDVVSFRELLVKRVQ---------DELVNNYKFEQTTFAASDLIRAHN 274

  Fly   286 EDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELAR-NQDVQDKLREEIGNVFGKHNKEFTYEG 349
            .:.:.:.:|.....|..|||.|........:||.||: :.:.|:|||:|:..:...       :|
Yeast   275 NEIIDYKQLTDNIVIILVAGHENPQLLFNSSLYLLAKYSNEWQEKLRKEVNGITDP-------KG 332

  Fly   350 IKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIY-PEP 413
            :.::..|...:.|.:|.||.|:.:.....|.......:..|.||..|.....|..:||..: ...
Yeast   333 LADLPLLNAFLFEVVRMYPPLSTIINRCTTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTA 397

  Fly   414 EIFKPERF-TDEEI------AARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSP 471
            :.|||||: :|.|.      .|:..|....|..|.|.|:|.:..:.:..:.||.:::.:::|:.|
Yeast   398 DDFKPERWGSDIETIRKNWRMAKNRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDP 462

  Fly   472 ETQ---------IPMKIVVK---NIL 485
            |.:         .|:.:.:|   ||:
Yeast   463 EWEEKLTPAGPLCPLNLKLKFNENIM 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 106/469 (23%)
DIT2NP_010690.1 CYP56-like 65..485 CDD:410693 105/467 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.