DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP721A1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:503 Identity:124/503 - (24%)
Similarity:210/503 - (41%) Gaps:102/503 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PHDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKD 95
            ||:.||.:..:..:|  .|...:.|                .::|.::..|.|....|.|..:..
plant    71 PHEFVHRVAPHYHEW--SRVYGKTF----------------LYWFGSKPVVATSDPRLIREALTT 117

  Fly    96 FNHFENRGVFYNEIDDPLSATLFS-----IEGQKWRHLRHKLTPTFTSGKMKNMFPIVV------ 149
            ...|:..|      .:|||..|::     :.|.:|...|......||..|:|...|.:|      
plant   118 GGSFDRIG------HNPLSKLLYAQGLPGLRGDQWAFHRRIAKQAFTMEKLKRWVPQMVTSTMML 176

  Fly   150 --------KVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS 206
                    ..|||::              |||...:...:|:::...|||   ||:.:.|..| .
plant   177 MEKWEDMRNGGEEIE--------------LEVHKEMHNLSAEMLSRTAFG---NSVEEGKGIF-E 223

  Fly   207 IGKRAITEH---RYGNMLDIFLFGFP-KLSRRL-RLKLNIQEAEDFYTKIVRETIDYRLRTKEKR 266
            :.:|.:...   |:...:..|.| || |.:|.: |::..|:.:       :.:.|:......||.
plant   224 LQERMMRLFYLVRWSVYIPGFRF-FPSKTNREIWRIEKQIRVS-------ILKLIENNKTAVEKS 280

  Fly   267 NDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLR 331
            ...:.:.:..|.| |:| .|:.|...|:..:...|:.|..||::..|.|.|..||.||:.|:..|
plant   281 GTLLQAFMSPYTN-QNG-QEEKLGIEEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEWQNIAR 343

  Fly   332 EEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMT-------DTDFSPEDPKYF 389
            ||:..|.|:.... |.:.::::|.|..::.||||.||....|.|.|       |.|         
plant   344 EEVICVLGQTGLP-TLDILQDLKTLSMIINETLRLYPPAMTLNRDTLKRAKLGDLD--------- 398

  Fly   390 IAKGTIVVIPALGIHYDPDIY-PEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQ 453
            |..||.:.:..:.:|:|.:.: .:.|.|.|.||.|.:   :.|...:|||.|||.|:|....:.:
plant   399 IPAGTQLYLSVVAMHHDKETWGDDAEEFNPRRFEDPK---KQSALLVPFGLGPRTCVGQNLAVNE 460

  Fly   454 TCVGLAYLIRGYKFSVSPE-TQIPMKIVVKNILISAENGIHLKVEKLA 500
            ....||.:::.|.|.:||. ...|:..|.    :..:||.||...:::
plant   461 AKTVLATILKYYSFRLSPSYAHAPVLFVT----LQPQNGAHLLFTRIS 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 116/474 (24%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 120/492 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.