DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP89A7

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_176673.1 Gene:CYP89A7 / 842801 AraportID:AT1G64930 Length:511 Species:Arabidopsis thaliana


Alignment Length:483 Identity:113/483 - (23%)
Similarity:195/483 - (40%) Gaps:131/483 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TRTAV-VTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSI------------EGQKWRHL 128
            :|.|: |.|..|..:.|:.      |..||   .|.|.:|.:..|            .|..||.|
plant    76 SRPAIFVADGSLAHQALVL------NGAVF---ADRPPAAPISKILSNNQHTITSCLYGVTWRLL 131

  Fly   129 RHKLTPTFTSGKMKN----------------------------------MFPIVVKV--GEEMD- 156
            |..:|......:||:                                  ||.::|.:  |:::| 
plant   132 RRNITEILHPSRMKSYSHVRHWVLEILFDRLRKSGGEEPIVVFDHLHYAMFAVLVLMCFGDKLDE 196

  Fly   157 KVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNML 221
            |..:......|..:|.    .|||:  ::..|           ||                    
plant   197 KQIKQVEYVQRQMLLG----FARYS--ILNLC-----------PK-------------------- 224

  Fly   222 DIFLFGFPKLSRRLRLKLNIQ---EAEDFYTKIV---RETIDYRLR----TKEKRNDFMDSLIEM 276
                  |.||..|.|.:...|   |.:|...:::   |:.::.|.:    .:|:..:::.|.::.
plant   225 ------FTKLILRKRWEEFFQMRREQQDVLLRLIYARRKIVEERKKRSSEEEEENKEYVQSYVDT 283

  Fly   277 YKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKH 341
            ..:.:..:.:..|..:|:::....|.:||.:|::|.:.:.:..|.:||::|::|.|||.||.|:.
plant   284 LLDVELPDEKRKLNEDEIVSLCSEFLIAGSDTTATVLQWIMANLVKNQEIQERLYEEITNVVGEE 348

  Fly   342 NKEFTYEGIKEMKYLEQVVMETLRKYP----VLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALG 402
            .|....:..::|.||:.||||.||::|    ||.|...........:.||    ||||..:.| .
plant   349 AKVVEEKDTQKMPYLKAVVMEALRRHPPGNTVLPHSVTEDTVLGGYKVPK----KGTINFLVA-E 408

  Fly   403 IHYDPDIYPEPEIFKPERFTDEE----IAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIR 463
            |..||.::.||..||||||..||    |........:|||.|.|.|.|:...|:.....:|.::|
plant   409 IGRDPKVWEEPMAFKPERFMGEEEAVDITGSRGIKMMPFGAGRRICPGIGLAMLHLEYYVANMVR 473

  Fly   464 GYKF------SVSPETQIPMKIVVKNIL 485
            .:::      .|....::...:::|:.|
plant   474 EFQWKEVEGHEVDLTEKVEFTVIMKHPL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 111/474 (23%)
CYP89A7NP_176673.1 CYP77_89 65..502 CDD:410698 113/483 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.