DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP97A3

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:521 Identity:131/521 - (25%)
Similarity:224/521 - (42%) Gaps:88/521 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GIPHDEVHPLF---GNIKDWPN----KRHIAEIFRDYYFKYKNSDYP-------FAGFF---FFF 76
            |||.:.:..:|   |:.:|:|.    |..|..:..:.:|      .|       :.|.|   |..
plant    91 GIPSNVLDFMFDWTGSDQDYPKVPEAKGSIQAVRNEAFF------IPLYELFLTYGGIFRLTFGP 149

  Fly    77 TRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKM 141
            ....:|:|..:.|.:| ||.....::|:....:|..:...|...:|:.||..|..:.|..   ..
plant   150 KSFLIVSDPSIAKHIL-KDNAKAYSKGILAEILDFVMGKGLIPADGEIWRRRRRAIVPAL---HQ 210

  Fly   142 KNMFPIVVKVGEEMDKVFRS-KTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFV 205
            |.:..::...||..|::.:. ..||.:|:.:|:..|.:|.|.|:||...|..:.:||.:......
plant   211 KYVAAMISLFGEASDRLCQKLDAAALKGEEVEMESLFSRLTLDIIGKAVFNYDFDSLTNDTGVIE 275

  Fly   206 SIGKRAITEHRYGNMLDIFLFGFP------KLSRRLRLKLNIQEAEDFYTKIVRETIDYRLRT-- 262
            :: ...:.|....::..|.::..|      ...|::...|          |::.:|:|..:.|  
plant   276 AV-YTVLREAEDRSVSPIPVWDIPIWKDISPRQRKVATSL----------KLINDTLDDLIATCK 329

  Fly   263 ---KEKRNDFMDSLIEMYKNEQSGN-------SEDGLTFNELLAQAFIFFVAGFETSSTTMGFAL 317
               :|:...|.    |.|.||:..:       |.|.::..:|........:||.|||:..:.:..
plant   330 RMVEEEELQFH----EEYMNERDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTF 390

  Fly   318 YELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKY---PVLAHLTRMTDT 379
            |.|.....|..||:||:.:|.|  ::..|.:.:|::||..:|:.|:||.|   |||  :.|..|.
plant   391 YLLTTEPSVVAKLQEEVDSVIG--DRFPTIQDMKKLKYTTRVMNESLRLYPQPPVL--IRRSIDN 451

  Fly   380 DFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERF---------TDEEIAARPSCTWL 435
            |...|.|   |.:|..:.|....:|..|..:.:.|.|.|||:         |::..      ::|
plant   452 DILGEYP---IKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQNF------SYL 507

  Fly   436 PFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKVEKLA 500
            |||.|||.|||..|...:..|.:|.|||.:.|.::|... |:|:.. ...|....|:.|.|.|..
plant   508 PFGGGPRKCIGDMFASFENVVAIAMLIRRFNFQIAPGAP-PVKMTT-GATIHTTEGLKLTVTKRT 570

  Fly   501 K 501
            |
plant   571 K 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 121/489 (25%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 131/521 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.