DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:309 Identity:60/309 - (19%)
Similarity:117/309 - (37%) Gaps:83/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAA-------RRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAE----- 53
            :.|:..:::||:.:..|.       :|...|.:::|...:....|.|::::......:|.     
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSLPLP 74

  Fly    54 IFRDY-----------YFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIK----------DFN 97
            :..|:           ..|:....:.:.|.:    ...:|.|.|.|:.::.|          ..|
plant    75 LDADFLPRMMPFLHHTVLKHGKKCFTWYGPY----PNVIVMDPETLREIMSKHELFPKPKIGSHN 135

  Fly    98 HFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPI----VVKVGEEMDKV 158
            |     ||       ||. |.:.||.||...|..|.|.|....:|::.|.    ..::.||.:::
plant   136 H-----VF-------LSG-LLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERL 187

  Fly   159 FRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCN---SLYDPKAEFVSIGKRAITEHRYGNM 220
            ..:|...:........||    |.:::...:||.:..   .:::.:.|.:.:|..||..      
plant   188 ASAKGTMELDSWTHCHDL----TRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRA------ 242

  Fly   221 LDIFLFG---FP-KLSRRLRLKLNIQEAEDFYTKIVRETIDYRLRTKEK 265
              :::.|   .| |.:||||      |.|    :.:|......:.|||:
plant   243 --VYIPGSKFLPTKFNRRLR------ETE----RDMRAMFKAMIETKEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 53/267 (20%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.