DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP714A2

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_197872.1 Gene:CYP714A2 / 832559 AraportID:AT5G24900 Length:525 Species:Arabidopsis thaliana


Alignment Length:492 Identity:123/492 - (25%)
Similarity:209/492 - (42%) Gaps:70/492 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IPHDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIK 94
            |.||....||.:...|  ::....|: .|....|.        ..:.....:|.::.....:.:.
plant    78 ISHDYSSSLFPHFDHW--RKQYGRIY-TYSTGLKQ--------HLYINHPEMVKELSQTNTLNLG 131

  Fly    95 DFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVG------- 152
            ...|...|      ::..|...:.:..|..|.|.|..:...||..|:|.|..::|:..       
plant   132 RITHITKR------LNPILGNGIITSNGPHWAHQRRIIAYEFTHDKIKGMVGLMVESAMPMLNKW 190

  Fly   153 EEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEF-------VSIGKR 210
            |||     .|...:.|..:.|.:.:...:||||....||   :|....||.|       .:|.||
plant   191 EEM-----VKRGGEMGCDIRVDEDLKDVSADVIAKACFG---SSFSKGKAIFSMIRDLLTAITKR 247

  Fly   211 AITEHRYGNMLDIFLFGFPKLSRRLRLKLNIQEAEDFYTKIVRETIDYR-LRTKE-KRNDFMDSL 273
            ::. .|:....|: :||..|..     .::|...|......:.||:..| :..|: .:.|.|..:
plant   248 SVL-FRFNGFTDM-VFGSKKHG-----DVDIDALEMELESSIWETVKEREIECKDTHKKDLMQLI 305

  Fly   274 IEMYKNEQSGNSEDGLTFNELLAQ--AFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGN 336
            :|.......||..|...:...:..  ..|:| ||.::::.::.:.|..||.|...|.|:|:||  
plant   306 LEGAMRSCDGNLWDKSAYRRFVVDNCKSIYF-AGHDSTAVSVSWCLMLLALNPSWQVKIRDEI-- 367

  Fly   337 VFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIV--VIP 399
            :....|.....|.|..:|.:..|:.||:|.||....:.|....|....|  ..:.||..:  :||
plant   368 LSSCKNGIPDAESIPNLKTVTMVIQETMRLYPPAPIVGREASKDIRLGD--LVVPKGVCIWTLIP 430

  Fly   400 ALGIHYDPDIY-PEPEIFKPERFTDEEIAARPSC----TWLPFGEGPRNCIGLRFGMMQTCVGLA 459
            ||  |.||:|: |:...||||||::   ....:|    :::|||.|||.|:|..||||:..|.::
plant   431 AL--HRDPEIWGPDANDFKPERFSE---GISKACKYPQSYIPFGLGPRTCVGKNFGMMEVKVLVS 490

  Fly   460 YLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKV 496
            .::..:.|::||..|....   ..:|:..::|:.::|
plant   491 LIVSKFSFTLSPTYQHSPS---HKLLVEPQHGVVIRV 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 117/466 (25%)
CYP714A2NP_197872.1 p450 37..524 CDD:299894 122/490 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.