DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP709B3

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_194501.1 Gene:CYP709B3 / 828885 AraportID:AT4G27710 Length:518 Species:Arabidopsis thaliana


Alignment Length:517 Identity:136/517 - (26%)
Similarity:234/517 - (45%) Gaps:81/517 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALI--------VVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDW------------ 45
            :|||.::        :::|..|:.:.|     ::::||...:...|:||:.:.            
plant    13 VLLLFVVSKIWKACWILLLRPLMLSKR-----FKKQGISGPKYKILYGNLSEIKKMKKEADLCVL 72

  Fly    46 -PNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFT---RTAVVTDMELLKRVLIKDFNHFENRGVFY 106
             ||..   :||...:.:|......:...|.|:|   .|..:::.||.|:||...|      |...
plant    73 DPNSN---DIFPRVFPQYHQWMSQYGDTFLFWTGTKPTIYISNHELAKQVLSSKF------GFTI 128

  Fly   107 NEIDDPLSATLFS-----IEGQKWRHLRHKLTPTFTSGKMKNMF-PI---VVKVGEEMDKVFRSK 162
            ..:..|....||.     |:|..|...|..|.|.|:..::|.|. |:   .:::.||..|..|: 
plant   129 IPVKRPEVFILFGKGLSFIQGDDWIRHRRILNPAFSMDRLKAMTQPMGDCTLRIFEEWRKQRRN- 192

  Fly   163 TAADRGQVLEVVDLVARY---TADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRY--GNMLD 222
                 |:||..:::...:   |||:|...|||    |.|   ||.:.:.:......:|  .::.:
plant   193 -----GEVLIKIEISKEFHKLTADIIATTAFG----SSY---AEGIELCRSQTELEKYYISSLTN 245

  Fly   223 IFLFGFPKLSRRLRLKLNIQEAEDFYTKI---VRETIDYRLRTKEKRNDFMDSLI-EMYKNEQSG 283
            :|:.|...|.....|||     .:.:.|:   ::..||.||::|.|...:.|.|: .|....:|.
plant   246 VFIPGTQYLPTPTNLKL-----WELHKKVKNSIKRIIDSRLKSKCKTYGYGDDLLGVMLTAAKSN 305

  Fly   284 NSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYE 348
            ..|..:..:|::.:...|:.||..|:|..:.:....|:.:|..|:|||||:.|..||.....| :
plant   306 EYERKMRMDEIIEECKNFYYAGQGTTSILLTWTTMLLSLHQGWQEKLREEVFNECGKDKIPDT-D 369

  Fly   349 GIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPE- 412
            ...::|.:..|:||:||.|..:..::|....|......:  |.|||.::||.|.:|.|..|:.| 
plant   370 TFSKLKLMNMVLMESLRLYGPVIKISREATQDMKVGHLE--IPKGTSIIIPLLKMHRDKAIWGED 432

  Fly   413 PEIFKPERFTD--EEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPE 472
            .|.|.|.||.:  .:....|:.. |||..|||.||...|.|::....|..:::.::.|:|||
plant   433 AEQFNPLRFENGISQATIHPNAL-LPFSIGPRACIAKNFAMVEAKTVLTMILQQFQLSLSPE 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 128/474 (27%)
CYP709B3NP_194501.1 p450 9..517 CDD:299894 136/517 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.