DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP71A27

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_193757.3 Gene:CYP71A27 / 827771 AraportID:AT4G20240 Length:451 Species:Arabidopsis thaliana


Alignment Length:354 Identity:83/354 - (23%)
Similarity:148/354 - (41%) Gaps:51/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIV 148
            |::...|...|..|.|...|   .:|       :|...|:.|:.::........:.||...|.  
plant    94 DLKFANRPKSKAINIFMEGG---RDI-------IFGPYGEDWKSMKSLGVVHLLNNKMVRSFE-- 146

  Fly   149 VKVGEEMDKVFRSK--TAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRA 211
             .:.||..||...|  .|:.....:.:..|:...|.|:|.....|..    |:.:...:.|....
plant   147 -NLREEEIKVMTEKLEEASSSSSSVNLSKLLMTLTNDIICRITLGRK----YNEEEGGIDIKNLV 206

  Fly   212 ITEHRYGNMLDIFLFG--FPKLS------------RRLRLKLNIQEAEDFYTKIVRETIDYRLRT 262
            :|...:   ...|.||  .|.|:            :.:..||:.     |...:|:|.:|   ..
plant   207 MTSSEF---FGKFFFGDFIPSLAWIDWISGIDDKMKDINNKLDC-----FLDSMVQEHVD---AD 260

  Fly   263 KEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQ 327
            .::.:||:|.|:.:.|::......|.   ::|:......|.:|..|:::.:.:.:.||.|:.:..
plant   261 HKEPSDFIDMLLLIQKDKTKRFKFDR---SDLILILKDMFFSGTATTASQLEWTMTELMRHPECM 322

  Fly   328 DKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAK 392
            .||::|| |.|..||...|.:.:::|.||..|:.|.||.:|....|.|:...|...:.  |.|:.
plant   323 KKLQDEI-NSFSTHNLNVTEKEVEKMNYLHCVIKEGLRLHPSGPLLFRLPSEDVQLKG--YDISA 384

  Fly   393 GTIVVIPALGIHYDPDIYP-EPEIFKPER 420
            ||.|:|.|..:..:|.|:. :...::|||
plant   385 GTHVIINAWALQRNPAIWGLDANEYRPER 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 83/354 (23%)
CYP71A27NP_193757.3 p450 33..439 CDD:299894 83/354 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.