DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and LUT1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_190881.2 Gene:LUT1 / 824479 AraportID:AT3G53130 Length:539 Species:Arabidopsis thaliana


Alignment Length:507 Identity:129/507 - (25%)
Similarity:217/507 - (42%) Gaps:83/507 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GIP-----HDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPF----AGFFFFFTRTAVVTD 84
            |||     .|:|..|.|.....|            .:|:.|...|.    ||...|    .:|:|
plant    78 GIPIANAKLDDVADLLGGALFLP------------LYKWMNEYGPIYRLAAGPRNF----VIVSD 126

  Fly    85 MELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSI-EGQKWRHLRHKLTPT----FTSGKMKNM 144
            ..:.|.|| :::..:. :|: ..|:.:.|..:.|:| ||..|...|..:.|:    :.|..::.:
plant   127 PAIAKHVL-RNYPKYA-KGL-VAEVSEFLFGSGFAIAEGPLWTARRRAVVPSLHRRYLSVIVERV 188

  Fly   145 FPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLY--DPKAEFVSI 207
            |   .|..|.:  |.:.:..|:.|..:.:....::.|.||||...|..|.:||.  .|..|.|  
plant   189 F---CKCAERL--VEKLQPYAEDGSAVNMEAKFSQMTLDVIGLSLFNYNFDSLTTDSPVIEAV-- 246

  Fly   208 GKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLNIQEAEDFYTKIVRETIDYRL--------RTKE 264
                .|..:...:....|..:.|:....::.....:||...| ::|||::..:        |..|
plant   247 ----YTALKEAELRSTDLLPYWKIDALCKIVPRQVKAEKAVT-LIRETVEDLIAKCKEIVEREGE 306

  Fly   265 KRNDFMDSLIEMYKNEQSGN-------SEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELAR 322
            :.||      |.|.|:...:       |.:.::..:|........|||.||:.:.:.:.||.|::
plant   307 RIND------EEYVNDADPSILRFLLASREEVSSVQLRDDLLSMLVAGHETTGSVLTWTLYLLSK 365

  Fly   323 NQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDT-DFSPEDP 386
            |.....|.:||:..|....|..|  |.|||:||:.:.:.|::|.||....|.|.... |..|.: 
plant   366 NSSALRKAQEEVDRVLEGRNPAF--EDIKELKYITRCINESMRLYPHPPVLIRRAQVPDILPGN- 427

  Fly   387 KYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCT-----WLPFGEGPRNCIG 446
             |.:..|..::|....||...:::.:.|.|.||||..:  .|.|:.|     ::||..|||.|:|
plant   428 -YKVNTGQDIMISVYNIHRSSEVWEKAEEFLPERFDID--GAIPNETNTDFKFIPFSGGPRKCVG 489

  Fly   447 LRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKVEK 498
            .:|.:|:..|.||..::.....:.|:..|.|   .....|...||:::||.:
plant   490 DQFALMEAIVALAVFLQRLNVELVPDQTISM---TTGATIHTTNGLYMKVSQ 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 118/473 (25%)
LUT1NP_190881.2 PLN02936 56..539 CDD:178524 129/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.