DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP705A32

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_188731.1 Gene:CYP705A32 / 821645 AraportID:AT3G20950 Length:526 Species:Arabidopsis thaliana


Alignment Length:395 Identity:106/395 - (26%)
Similarity:180/395 - (45%) Gaps:69/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SATLFSIEGQKWRHLRHKLTPTFTSG--------KMKNMFPIVVKVGEEMDKVFRSKTAADRGQV 170
            |:..|:..|..::.:| ||..|...|        |::         .:|:|:.:|:  ..|:...
plant   128 SSFFFAPYGDYFKFMR-KLIATKLLGPQALERSRKIR---------ADELDRFYRN--LLDKAMK 180

  Fly   171 LEVVDLV---ARYTADVIGNCAFGLNCNSLYDPKAEFVS---IGKRAITEHRYGNMLDIFLFGFP 229
            .|.||:|   |:...::|.....|.:| |..:.:||.|.   |...|:|:..:..|:      |.
plant   181 KESVDIVEEAAKLNNNIICKMIMGRSC-SEDNGEAERVRGLVIESTALTKQIFLGMI------FD 238

  Fly   230 KLSRRLRLKL------NIQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDG 288
            |..::|.:.|      ::...::...||:.|. :.|:....|.||.||.|:|.|.:|   |:|..
plant   239 KPLKKLGISLFQKDIKSVSRFDELLEKILVEH-EERMGKHYKANDMMDLLLEAYGDE---NAEYK 299

  Fly   289 LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYE-GIKE 352
            :|.|.:.:......:||.:||:.|:.:.:.||..|.::.::|||||.:|.|  |.....| .:..
plant   300 ITRNHIKSLFVDLVIAGTDTSAQTIEWTMAELINNPNILERLREEIESVVG--NTRLVQETDLPN 362

  Fly   353 MKYLEQVVMETLRKYPVLAHLTRMTDTDFSP--EDPKYFIAKGTIVVIPALGIHYDPDIYPEPEI 415
            :.||:.||.|.||.:|..|...|    .|..  |...::|.:.|::|:....|..||.::.:||.
plant   363 LPYLQAVVKEGLRLHPPGAVFLR----TFQERCELKGFYIPEKTLLVVNVYAIMRDPKLWEDPEE 423

  Fly   416 FKPERFT------DEEIAARPSCTWLPFGEGPRNC---------IGLRFGMMQTCVGLAYLIRGY 465
            ||||||.      .|:........::||..|.|.|         :|...|:|..|  ..:.|:|.
plant   424 FKPERFIASSRSGQEDEIREEVLKYMPFSTGRRGCPGSNLAYVSVGTAIGVMAQC--FDWRIKGE 486

  Fly   466 KFSVS 470
            |.:::
plant   487 KVNMN 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 106/395 (27%)
CYP705A32NP_188731.1 p450 16..514 CDD:299894 106/395 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.