DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP709B2

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:524 Identity:130/524 - (24%)
Similarity:234/524 - (44%) Gaps:93/524 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAAR----------RRHGYWQRRGIPHDEVHPLFGNIKDW---------- 45
            :|.:||:::::..:..|.|          ||   ::::||...:...|:||:::.          
plant    64 LLAIALVLLVVPKIYGACRILVWRPWMLSRR---FKKQGISGPKYRILYGNLREIRKMKNEAKLM 125

  Fly    46 ---PNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRT---AVVTDMELLKRVLIKDFNHFENRGV 104
               ||...|......:..::|:.   :...|.::..|   ..::|.||.|::|       .|:.|
plant   126 VLDPNSNDIVPRVLPHLQQWKSQ---YGETFLYWQGTDPRLCISDHELAKQIL-------SNKFV 180

  Fly   105 FYN------EIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFR--- 160
            |::      ||.......|..:.|..|...|..|.|.|:..|:|.|..::|      |..||   
plant   181 FFSKSKTKPEILKLSGNGLIFVNGLDWVRHRRILNPAFSMDKLKLMTQLMV------DCTFRMFL 239

  Fly   161 ----SKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHR--YGN 219
                .:...:..|.:.:.....|.|||:|...|||    |.|   ||.:.:.|..:...:  ...
plant   240 EWKKQRNGVETEQFVLISREFKRLTADIIATAAFG----SSY---AEGIEVFKSQLELQKCCAAA 297

  Fly   220 MLDIFLFGFPKLSR-------RLRLKLNIQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMY 277
            :.|::..|...|..       :|.:|:|         ..::..||.||.::.|  |:.:.|:.:.
plant   298 LTDLYFPGIQYLPTPSNLQIWKLDMKVN---------SSIKRIIDARLTSESK--DYGNDLLGIM 351

  Fly   278 KNEQSGN-SEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKH 341
            ....|.| ||..::.:|::.:...||.||.||::..:.::...|:.:||.|:|||||:.|..|| 
plant   352 LTAASSNESEKKMSIDEIIEECKTFFFAGHETTANLLTWSTMLLSLHQDWQEKLREEVFNECGK- 415

  Fly   342 NKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYD 406
            :|....|...::|.:..|.||:||.|..:.:|.|:...|....:.:  |.|||.:::|...:|.|
plant   416 DKIPDAETCSKLKLMNTVFMESLRLYGPVLNLLRLASEDMKLGNLE--IPKGTTIILPIAKMHRD 478

  Fly   407 PDIY-PEPEIFKPERFTD--EEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFS 468
            ..:: .:.:.|.|.||.:  ...|..|:.. |.|..|||.|||..|.:|:....||.:::.::.:
plant   479 KAVWGSDADKFNPMRFANGLSRAANHPNAL-LAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLN 542

  Fly   469 VSPE 472
            :|.:
plant   543 LSAD 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 121/479 (25%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 125/499 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.