DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP705A8

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_180268.1 Gene:CYP705A8 / 817242 AraportID:AT2G27000 Length:514 Species:Arabidopsis thaliana


Alignment Length:520 Identity:114/520 - (21%)
Similarity:213/520 - (40%) Gaps:98/520 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVH-PLFGNIKDWPNKRHIAEIFRDYYFKYKN 64
            :|:|..::.||....|..:.:.|:    .:|..... |:.|::      .|:..:|.....:..:
plant    14 ILILLCLLSILCYSFFFKKPKDGF----NLPPSPPSLPIIGHL------HHLLSLFMHRSLQKLS 68

  Fly    65 SDY-PFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLS-ATLF--------S 119
            |.| |......|.....:|:...:...:       |..:.|..:..|.|.: .:||        :
plant    69 SKYGPLLYLHVFNVPILLVSSPSIAYEI-------FRAQDVNVSTRDFPTNEGSLFLGSFSFITA 126

  Fly   120 IEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEE-------MDKVFRSKTAADRGQVLEVVDLV 177
            ..|:.|:.:: ||..|...|.........::..|.       :||..:.::       :|:.|..
plant   127 PYGEYWKFMK-KLIVTKLLGPQALERSQRIRANEVERFYSNLLDKAMKKES-------VEIADEA 183

  Fly   178 ARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFG--------------F 228
            .:...::|.....|..| |..:.:||.:   :..:|  :...:|..||..              |
plant   184 MKLVNNIICKMIMGRTC-SEENGEAERI---RGLVT--KSDALLKKFLLAAILRKPLKKIGITLF 242

  Fly   229 PKLSRRLRLKLNIQEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNE 293
            .|:...:.||.     ::...||:.|. :.||...::..|.||.|:|:|.::   .||..:|.:.
plant   243 KKVFMDISLKF-----DEVLEKILVEN-EERLEENQQGTDIMDKLLEVYGDK---TSEYKITRDH 298

  Fly   294 LLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQ 358
            :.:.....|.||.:|::.|:.:.:.|:..|..:.::|||||.:|.|| .:......:..:.||:.
plant   299 IKSLFVDLFFAGTDTATHTIEWTMAEIMNNSLILERLREEIDSVVGK-TRLIQETDLPNLLYLQA 362

  Fly   359 VVMETLRKYPVLAHLTR-----MTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKP 418
            .|.|.||.:|.:..:.|     .|...||       |.|.|.:|:....|..|||.:.:|..|||
plant   363 TVKEGLRLHPTIPLVLRTFQDGCTIGGFS-------IPKKTKLVVNGYAIMRDPDNWEDPLEFKP 420

  Fly   419 ERF------TDEEIAARPSCTWLPFGEGPRNC--IGLRFGMMQTCVGLA-----YLIRGYKFSVS 470
            |||      :.::........:|.||.|.|.|  :.|.:..::|.:|:.     :.|.|:|.:::
plant   421 ERFLASSRSSQKDAIKEEVLKYLSFGSGRRGCPGVNLAYVSVETAIGVMVQCFDWKIDGHKINMN 485

  Fly   471  470
            plant   486  485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 107/485 (22%)
CYP705A8NP_180268.1 p450 55..506 CDD:299894 104/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.