DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp6d4

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_651082.1 Gene:Cyp6d4 / 42682 FlyBaseID:FBgn0039006 Length:515 Species:Drosophila melanogaster


Alignment Length:515 Identity:161/515 - (31%)
Similarity:284/515 - (55%) Gaps:28/515 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPL-FGNIKD-WPNKRHIAEIFRDYYFKYKNS 65
            |:.|.|.:|:|..|..:|.:.||:|||.|.::...: ||.:.. |..::.:.....|.|.|.|..
  Fly     4 LILLAVTLLTLAWFYLKRHYEYWERRGFPFEKHSGIPFGCLDSVWRQEKSMGLAIYDVYVKSKER 68

  Fly    66 DYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRH 130
               ..|.:..|....::.|.:|.:|||.:||..|.:|||:.:|..|||||.:||:.||.||.:||
  Fly    69 ---VLGIYLLFRPAVLIRDADLARRVLAQDFASFHDRGVYVDEERDPLSANIFSLRGQSWRSMRH 130

  Fly   131 KLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCN 195
            .|:|.|||||:|:||.....:|::|....:.:...:..:.:::..::..|..|:|.:..|||:.|
  Fly   131 MLSPCFTSGKLKSMFSTSEDIGDKMVAHLQKELPEEGFKEVDIKKVMQNYAIDIIASTIFGLDVN 195

  Fly   196 SLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSR---RLRLKLNIQEAEDFYTKIVRETID 257
            |..:|..:|..:...|...:|:..|..:.:|..|.:::   |:..|..:..|   ..:||:||::
  Fly   196 SFENPDNKFRKLVSLARANNRFNAMFGMMIFLVPSIAQFLFRIGFKNPVGLA---MLQIVKETVE 257

  Fly   258 YRLRTKEKRNDFMDSLIEMY------KNEQSG----NSEDG----LTFNELLAQAFIFFVAGFET 308
            ||.:....|.|.:..||::.      :|::..    .:.||    ::...:.||||||::||.||
  Fly   258 YREKHGIVRKDLLQLLIQLRNTGKIDENDEKSFSIQKTPDGHIKTISLEAITAQAFIFYIAGQET 322

  Fly   309 SSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHL 373
            :.:|..|.:||||:..::..:|::|:.....|::.:.||:.:.:|::|:..|.||:||||.|..|
  Fly   323 TGSTAAFTIYELAQYPELLKRLQDEVDETLAKNDGKITYDSLNKMEFLDLCVQETIRKYPGLPIL 387

  Fly   374 TRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFG 438
            .|....|::..|..:.|.|||.|||...|||:|.:.:|:||.:.||||::|.....|: .::|||
  Fly   388 NRECTQDYTVPDTNHVIPKGTPVVISLYGIHHDAEYFPDPETYDPERFSEESRNYNPT-AFMPFG 451

  Fly   439 EGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLKVEK 498
            ||||.||..|.|.:.:.:.:..:::.:...|...::|..:  ...|.:..::|:.:::.|
  Fly   452 EGPRICIAQRMGRINSKLAIIKILQNFNVEVMSRSEIEFE--NSGIALIPKHGVRVRLSK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 145/460 (32%)
Cyp6d4NP_651082.1 p450 58..500 CDD:278495 143/450 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461189
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3345
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
109.900

Return to query results.
Submit another query.