DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4F3

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:480 Identity:124/480 - (25%)
Similarity:216/480 - (45%) Gaps:74/480 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 WPNKRH-IAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNE 108
            |....| |..||...|.|      |     ..|...|:|.          ||       .|||:.
Human    91 WVGPWHAIVRIFHPTYIK------P-----VLFAPAAIVP----------KD-------KVFYSF 127

  Fly   109 IDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK---TAADRGQV 170
            :...|...|....|:||...|..|||.|..    |:....:|:..|...:..:|   .|::....
Human   128 LKPWLGDGLLLSAGEKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLASEGSAR 188

  Fly   171 LEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAITEHRYGNML---DIFLFGFPK 230
            |::.:.::..|.|.:..|.|..:.:....| :|:::  :...|:...|:..:|   | ||:....
Human   189 LDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYID-FLYYLTP 251

  Fly   231 LSRRLRLKLNIQEAEDFYTKIVRET--------ID--YRLRTKEKRNDFMDSLIEMYKNEQSGNS 285
            ..:|.|....:  ..||...:::|.        :|  .:.:.|.|..||:|.|:       ....
Human   252 DGQRFRRACRL--VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL-------LSKD 307

  Fly   286 EDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKEFTY 347
            |||  |:..::.|:|..|...|.:|:::.:.:.||.||::.:.|::.|:|:..:. .:..||..:
Human   308 EDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEW 372

  Fly   348 EGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPE 412
            :.:.::.:|...:.|:||.:|.:..::|....|....|.: .|.||.|.:|...|.|::|.::|:
Human   373 DDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR-VIPKGIICLISVFGTHHNPAVWPD 436

  Fly   413 PEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGM--MQTCVGLAYLIRGYKFSVSPETQI 475
            ||::.|.||..:.|..|....::||..|||||||..|.|  |:..:||..|    :|.|.|:...
Human   437 PEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL----RFRVLPDHTE 497

  Fly   476 PMKIVVKNILISAENGIHLKVEKLA 500
            |.:  ...:::.||.|:.|:||.|:
Human   498 PRR--KPELVLRAEGGLWLRVEPLS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 117/456 (26%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 120/473 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.