DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and cyp2p10

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_958919.1 Gene:cyp2p10 / 399485 ZFINID:ZDB-GENE-040120-1 Length:497 Species:Danio rerio


Alignment Length:485 Identity:113/485 - (23%)
Similarity:191/485 - (39%) Gaps:92/485 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLFGNIKDW-PNKRHIAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFE 100
            |..|::... |||.|:.  |.::..||..    ...|..|.:|..|:....|:|.|..:..::..
Zfish    45 PFIGDLHHIDPNKIHLQ--FTEFAEKYGK----IFSFRLFGSRIVVLNGYNLVKEVYTQQGDNLA 103

  Fly   101 NRGVFYNEIDDPLSAT-------LFSIEGQKWRHLRHKLTPT---FTSGKMKNMFPIVVKVG--- 152
            :|...      |:::.       |.:..|.||:|.|.....|   |..||......|..:.|   
Zfish   104 DRPTL------PITSAIIGDNRGLVASSGYKWKHQRRFALTTLRNFGLGKKNLELSINFECGFLN 162

  Fly   153 ----EEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAIT 213
                .|..:.|..:.                    ::.|....:.|..::..:.|:        :
Zfish   163 EAISNEQGRPFNPRL--------------------LLNNAVSNVICVLVFGNRFEY--------S 199

  Fly   214 EHRYGNMLD-----IFLFG---------FPKLSRRL-----RLKLNIQEAEDFYTKIVRE-TIDY 258
            :|.:.|:|:     ::|.|         ||.|.:.|     :|....|...||..:.|.| .:||
Zfish   200 DHHFQNLLNKINESVYLEGSIFVHLYNMFPWLMQLLPGPHKKLITLWQRVTDFVREKVNEHRVDY 264

  Fly   259 RLRTKEKRNDFMDS-LIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELAR 322
               ......|::|. |.||.|::.  ::..|.....|.......||||.||:|||:.:.|..:.:
Zfish   265 ---DPSSLRDYIDCFLAEMEKHKD--DTAAGFDVENLCMCTLDLFVAGTETTSTTLYWGLLYMIK 324

  Fly   323 NQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVL-AHLTRMTDTDFSPEDP 386
            ..::|.|:::||..|.|. :::.:......|.|...|:.|..|...:: .::.|.|..|...|  
Zfish   325 YPEIQAKVQQEIDAVVGS-SRQPSGSDRDNMPYTNAVIHEIQRMGNIIPLNVVRTTSEDTRIE-- 386

  Fly   387 KYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGM 451
            ||.|.|||:|:.....:.:|...:..|..|.|..|.|.|...|....:|||..|.|.|:|.:...
Zfish   387 KYSIPKGTLVIGSLTSVLFDESEWETPHSFNPGHFLDAEGKFRRRDAFLPFSLGKRVCLGEQLAR 451

  Fly   452 MQTCVGLAYLIRGYKFS----VSPETQIPM 477
            |:..:..:.:::.:.||    |.|.....|
Zfish   452 MELFLFFSSVLQRFTFSPPAGVEPSLDFKM 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 113/485 (23%)
cyp2p10NP_958919.1 p450 38..493 CDD:278495 113/485 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2076
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.