DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and cyp4t8

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_954686.2 Gene:cyp4t8 / 387527 ZFINID:ZDB-GENE-031219-3 Length:509 Species:Danio rerio


Alignment Length:530 Identity:131/530 - (24%)
Similarity:226/530 - (42%) Gaps:77/530 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFRDYYFKYKNS 65
            ::.||.::.::.||:.   ||.|.......|....|.|||::|::....|..|....:...|:  
Zfish    19 LIFLACLLTVVKLLIV---RRKGVKTMERFPGPPAHWLFGHVKEFRQDGHDLEKIVKWMELYQ-- 78

  Fly    66 DYPFAGFFFFFTRTAV--VTDMELLKRVLI----KDFNHFENRGVFYNEIDDPLSATLFSIEGQK 124
               ||...:|....||  :.....:|.:|.    ||...::   .|...:.|.|..:    .|||
Zfish    79 ---FAFPLWFGPSLAVLNIHHPSYVKTILTTTEPKDDYAYK---FFIPWLGDGLLVS----TGQK 133

  Fly   125 WRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQV-------LEVVDLVARYTA 182
            |...|..|||.|....:|   |.|..:.:.      :|...|:.:|       .|:...|:..|.
Zfish   134 WFRHRRLLTPGFHYDVLK---PYVKLISDS------TKVMLDKWEVHSRSEESFELFKHVSLMTL 189

  Fly   183 DVIGNCAFGLNCNSLYDP------KAEF-----VSIGKRAITEHRYGNMLDIFLFGFPKLSRRLR 236
            |.|..|||..|.|...|.      :|.|     |::..|....|...      :|.......|.|
Zfish   190 DSIMKCAFSCNSNCQTDSGTNPYIQAVFDLCHLVNLRFRVFPYHSKA------IFHLSPHGYRFR 248

  Fly   237 LKLNIQEAEDFYTKIVRETIDYRLRTKEKRN--------DFMDSLIEMYKNEQSGNSEDGLTFNE 293
            ...:|  |.:...:::|:..:. |:.:|::.        ||:|.|:......|.|.|::     :
Zfish   249 KAASI--AHNHTAEVIRKRKEV-LKMEEEQGIVKNRRYLDFLDILLSARDEHQQGLSDE-----D 305

  Fly   294 LLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKEFTYEGIKEMKYLE 357
            :.|:...|...|.:|:::.:.:..|.||.|.:.|:|.|:||.... ||...|  :|.:.::.|..
Zfish   306 IRAEVDTFMFEGHDTTASGISWIFYNLACNPEHQEKCRQEIQQALDGKATLE--WEDLNKIPYTT 368

  Fly   358 QVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFT 422
            ..:.|:||.:|.:..::|......:..|.: .:.:|..:.:...|||.:..::..|..|.|.||.
Zfish   369 MCIKESLRLHPPVPGISRKLTKPLTFFDGR-TVPEGCTIGVSIYGIHMNSTVWENPYKFDPLRFL 432

  Fly   423 DEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILIS 487
            .|.:|.|....::||..|||||||..|.|.:..|.:|..::.|.....|:....|   :..:::.
Zfish   433 PENVANRSPHAFVPFSAGPRNCIGQNFAMNEMKVAVALTLKRYYLIKDPDHTPKM---IPQVVLR 494

  Fly   488 AENGIHLKVE 497
            :.||||:|::
Zfish   495 SLNGIHIKIK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 117/474 (25%)
cyp4t8NP_954686.2 p450 46..501 CDD:306555 122/495 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.