DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP705A28

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001154631.1 Gene:CYP705A28 / 3768880 AraportID:AT3G20935 Length:348 Species:Arabidopsis thaliana


Alignment Length:290 Identity:78/290 - (26%)
Similarity:131/290 - (45%) Gaps:60/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 FPKLSRRLRLKL---NIQEAEDFYTKIVRE-TIDYRLRTKE---KRNDFMDSLIE-MYKNEQSGN 284
            |.|..::|.:.|   :|:.....:.:::.: .:::..:.:|   |.||.||.|:| |....|:.|
plant    37 FHKPLKKLGISLFQKDIKSVSPKFDELLEKFLVEHEEKMEEDHYKANDMMDLLLEAMEMRMQNVN 101

  Fly   285 -----------------------SEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDV 326
                                   |.:.|...|||       |||.:||:....:.:.||..|..:
plant   102 LCIKRVSNTKARKPPILFRYGKYSNNSLLLQELL-------VAGTDTSALATQWTMAELINNPTI 159

  Fly   327 QDKLREEIGNVFGKHNKEFTYE-GIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFI 390
            .::|||||.:|.|  |.....| .:..:.||:.||.|.||.:|..:...||:..  ..|...::|
plant   160 LERLREEIESVVG--NTRLIQETDLSNLPYLQSVVKEGLRLHPPASISVRMSQE--RCELGGFYI 220

  Fly   391 AKGTIVVIPALGIHYDPDIYPEPEIFKPERF-----TDEEIAARPS-CTWLPFGEGPRNC----- 444
            .:.|::|:....|..||:.:.:||.||||||     :::|...|.. ..::||..|.|.|     
plant   221 PEKTLLVVNTYAIMRDPNFWEDPEEFKPERFITSSRSEQEDEMREEVLKYIPFSAGRRGCPGSNL 285

  Fly   445 ----IGLRFGMMQTCVGLAYLIRGYKFSVS 470
                :|:..|:|..|  ..:.|:|.|.::|
plant   286 AYVSLGIAIGVMVQC--FDWRIKGEKVNMS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 78/290 (27%)
CYP705A28NP_001154631.1 p450 <13..346 CDD:299894 78/290 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D467733at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.