DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:511 Identity:160/511 - (31%)
Similarity:256/511 - (50%) Gaps:32/511 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRRGIPH---DEVHPLFGNIKDWPNKR-HIAEIFRDYYFK 61
            |||:.|:::.:..|.|..|.::.|::.|||||   ....|: ||:......| ...::||..|..
  Fly     1 MLLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPM-GNLGQLLFLRISFGDLFRQLYAD 64

  Fly    62 YKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEID--DPLSA-TLFSIEGQ 123
            .:|......|||.|.|...:|.|.||:::||||:||:|.||   :...|  ||:.| ||...:..
  Fly    65 PRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNR---FESADAGDPMGALTLPLAKYH 126

  Fly   124 KWRHLRHKLTPTFTSGKMKN-MFPIVVKVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGN 187
            .|:..|..::..||||:|:: |:..::.|..::::....|......:||.:..:...||.||.||
  Fly   127 HWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGN 191

  Fly   188 CAFGLNCNSLYDPKAEFVSIGKRAI-TEHRYGNMLDIF-LFGFPKLSRRLRLKLNIQEAEDFYTK 250
            ..:.||...|...::|.::..|... |..|  .:||.. :|..||.:..|:.|:..::    |.:
  Fly   192 LFYSLNVGGLRRGRSELITKTKELFNTNPR--KVLDFMSVFFLPKWTGVLKPKVFTED----YAR 250

  Fly   251 IVRETI-DYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMG 314
            .:|..: |:...||   .|.::.|.....:..|.:......|  :.:||.|..:|||||||..||
  Fly   251 YMRHLVDDHHEPTK---GDLINQLQHFQLSRSSNHYSQHPDF--VASQAGIILLAGFETSSALMG 310

  Fly   315 FALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTR---- 375
            |.|||||:..|:|::||.|:...| ......:|:.:..:.||:.|.:|.||.||..|.:.|    
  Fly   311 FTLYELAKAPDIQERLRSELREAF-ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTS 374

  Fly   376 MTDTDFSPEDPKYFIA-KGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGE 439
            .....||.:....||. .|....|..||:|.|...:|||.:|.||||..|........|::|||.
  Fly   375 SASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGA 439

  Fly   440 GPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHLK 495
            ||..|||.|.|::|..:|:.::::.|.......|...::...|:.::.:||.|:|:
  Fly   440 GPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 142/454 (31%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 143/467 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461081
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
109.900

Return to query results.
Submit another query.