DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp6w1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001286145.1 Gene:Cyp6w1 / 35543 FlyBaseID:FBgn0033065 Length:514 Species:Drosophila melanogaster


Alignment Length:532 Identity:182/532 - (34%)
Similarity:291/532 - (54%) Gaps:58/532 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDW-----P-----NKRHIAEIF 55
            ||||.|:..:..:.....||...:|:|.|:.:....|:.|..:::     |     .|.|.|..|
  Fly     1 MLLLLLLGSLTIVFYIWQRRTLSFWERHGVKYIRPFPVVGCTREFLTAKVPFFEQIQKFHEAPGF 65

  Fly    56 RDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLS-ATLFS 119
                     .:.||.|.:.......|:.|:||:|.|:||.|.:|.||.:..:..:|.|. ..||.
  Fly    66 ---------ENEPFVGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFF 121

  Fly   120 IEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADR---GQVLEVVDLVARYT 181
            .....||.||.|::|.|||||:|.|:|::||:|:.:      :.:|:|   |..::|.||.:|:|
  Fly   122 ARSPGWRELRTKISPVFTSGKIKQMYPLMVKIGKNL------QDSAERLGSGTEVQVKDLCSRFT 180

  Fly   182 ADVIGNCAFGLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDI-FLFGFPKLSRRLRLKLNIQEAE 245
            .|:|...|||:..|:|.|.|:||. ...|||........:|. .:|..|.|:...|:||..:|. 
  Fly   181 TDLIATIAFGVEANALQDAKSEFF-YHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFSRET- 243

  Fly   246 DFYTKIVRETIDY----RLRTKEKRNDFMDSLIEMYKNEQSGN----SEDGLTFNELLAQAFIFF 302
               ||.:|.:::|    |.||.|||||.:|.|:.: |.|.:.|    |:: :..:.|:|||.:|.
  Fly   244 ---TKFIRSSVNYVLKERERTGEKRNDLIDILLAL-KREAAANPGKMSKE-VDLDYLVAQAAVFQ 303

  Fly   303 VAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKY 367
            .||||||::||...|||||:|:.:||:||:||.:.||..: ..:||.|:||.||.|||.||||||
  Fly   304 TAGFETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDED-HISYERIQEMPYLSQVVNETLRKY 367

  Fly   368 PVLAHLTRMTDTDFSPEDPKYF---------IAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTD 423
            |::.::.|...   .|.:.:.|         :..|..:.:..:.:|.||..:|:||.:.||||..
  Fly   368 PIVGYIERECS---QPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKYDPERFNS 429

  Fly   424 EEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISA 488
            ..........::|||.|||||||:|.|::|:.:||.:::|.::|....:|...::....:.::::
  Fly   430 SNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKKIEWAPTSPVMAS 494

  Fly   489 ENGIHLKVEKLA 500
            :..|.|:|||::
  Fly   495 KRDIILRVEKVS 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 167/473 (35%)
Cyp6w1NP_001286145.1 p450 34..501 CDD:278495 168/492 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461129
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
1110.800

Return to query results.
Submit another query.