DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp4f39

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_796281.1 Gene:Cyp4f39 / 320997 MGIID:2445210 Length:532 Species:Mus musculus


Alignment Length:413 Identity:106/413 - (25%)
Similarity:194/413 - (46%) Gaps:34/413 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQ 169
            ||:.:...|...|...:|.||...|..|||.|....:|....|..:....|...:|...|.....
Mouse   132 FYSFLKPWLGDGLLISKGNKWSRHRRLLTPAFHFDILKPYMKIFNQCTNIMHAKWRRHLAEGSVT 196

  Fly   170 VLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--------IGKRAITEHRYGNMLDIFLF 226
            ..::.:.::..|.|.:..|.|..| :...:..::::|        :.:|....|.|   || |::
Mouse   197 SFDMFEHISLMTLDSLQKCVFSYN-SDCQERMSDYISSIIELSALVVRRQYRLHHY---LD-FMY 256

  Fly   227 GFPKLSRRLRLKLNIQEAEDFYTKIVRET--------IDYRLRTKE-KRNDFMDSLIEMYKNEQS 282
            ......||.|...:  ...:|.|::::|.        .:..|:.|: |..||:|.|: :.|:|:.
Mouse   257 YLTADGRRFRQACD--TVHNFTTEVIQERRQALRQQGAEAWLKAKQGKTLDFIDVLL-LAKDEEG 318

  Fly   283 GNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKEFT 346
            ....|    .::.|:|..|...|.:|:|:.:.:||:.||:..:.|:|.||||..|. |:..:|..
Mouse   319 KELSD----EDIRAEADTFMFEGHDTTSSGLSWALFNLAKYPEYQEKCREEIQEVMKGRELEELD 379

  Fly   347 YEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYP 411
            ::.:.::.:....:.|:||::|.:..::|....|....|.: .|.||.|.::...|.|::|.::|
Mouse   380 WDDLTQLPFTTMCIKESLRQFPPVTLISRRCTEDIKLPDGR-VIPKGIICLVSIYGTHHNPIVWP 443

  Fly   412 EPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIP 476
            :.:::.|.||..:....|....::||..|||||||..|.|.:..|.:|..:..::.||....::.
Mouse   444 DSKVYNPYRFDPDTPQQRSPLAFVPFSAGPRNCIGQSFAMAEMRVVVALTLLRFRLSVDRTHKVR 508

  Fly   477 MKIVVKNILISAENGIHLKVEKL 499
            .|   ..:::..|||:.|.||.|
Mouse   509 RK---PELILRTENGLWLNVEPL 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 98/390 (25%)
Cyp4f39NP_796281.1 p450 60..515 CDD:365848 99/398 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.