DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp4d1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_476907.2 Gene:Cyp4d1 / 31188 FlyBaseID:FBgn0005670 Length:512 Species:Drosophila melanogaster


Alignment Length:438 Identity:117/438 - (26%)
Similarity:197/438 - (44%) Gaps:59/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIV 148
            |:|::...|     .|.::...|..::..|...|....|:||...|..:||.| ..|:.:.|..|
  Fly    91 DVEVVLGTL-----RFNDKAGEYKALEPWLKEGLLVSRGRKWHKRRKIITPAF-HFKILDQFVEV 149

  Fly   149 VKVGE-------EMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS 206
            .:.|.       |.|::    ...|.|  ..:.|.:...|.|.|...|.|::.|:..:..:|:|.
  Fly   150 FEKGSRDLLRNMEQDRL----KHGDSG--FSLYDWINLCTMDTICETAMGVSINAQSNADSEYVQ 208

  Fly   207 IGK--RAITEHRYGNMLDIF--LFGFPKLSRRLRLKLNIQEAEDFYTKIV---RETIDYRLRTKE 264
            ..|  ..:...|..|:|..|  .:....|:|..:..||:  ...|..||:   ||.:.....::|
  Fly   209 AVKTISMVLHKRMFNILYRFDLTYMLTPLARAEKKALNV--LHQFTEKIIVQRREELIREGSSQE 271

  Fly   265 KRND-----------FMDSLIEMYKNEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALY 318
            ..||           |:|.|:      ||...|..|:..::..:...|...|.:|:|:.:.|..|
  Fly   272 SSNDDADVGAKRKMAFLDILL------QSTVDERPLSNLDIREEVDTFMFEGHDTTSSALMFFFY 330

  Fly   319 ELARNQDVQDKLREEIGNVFGK-HNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTR--MTDTD 380
            .:|.:.:.|.|..|||.:|.|. .:...:||.:.::.|::..|.||||.||.:..|.|  :.|.:
  Fly   331 NIATHPEAQKKCFEEIRSVVGNDKSTPVSYELLNQLHYVDLCVKETLRMYPSVPLLGRKVLEDCE 395

  Fly   381 FSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERF----TDEEIAARPSCTWLPFGEGP 441
            .:.:    .|..||.:.|..|.:....:::.||.|||||||    |.|::  .| ..::||..||
  Fly   396 INGK----LIPAGTNIGISPLYLGRREELFSEPNIFKPERFDVVTTAEKL--NP-YAYIPFSAGP 453

  Fly   442 RNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAE 489
            |||||.:|.|::....:|.::|.|:.....::..|..::.:.||.:.|
  Fly   454 RNCIGQKFAMLEIKAIVANVLRHYEVDFVGDSSEPPVLIAELILRTKE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 114/425 (27%)
Cyp4d1NP_476907.2 p450 35..507 CDD:278495 117/438 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.