DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:560 Identity:136/560 - (24%)
Similarity:246/560 - (43%) Gaps:136/560 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLALIVVILSLLVFAARRRHGYWQRRGI---PHDEVHPLFG-NIKD--------WPNKRHIAEIF 55
            ||:|.:|:...:.|..||:   |..:.:   |....|.|:| ::||        |..|       
  Rat    24 LLSLFLVLFKAVQFYLRRQ---WLLKALEKFPSTPSHWLWGHDLKDREFQQVLTWVEK------- 78

  Fly    56 RDYYFKYKNSDYPFAGF-FFFFTRTAVVT-DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLF 118
                       :|.|.. :...::|.|:. |.:.:|.||.:               .||.::.::
  Rat    79 -----------FPGACLQWLSGSKTRVLLYDPDYVKVVLGR---------------SDPKASGIY 117

  Fly   119 S----------------IEGQKW-RHLRHKLTPTFTSGKMK-------NMFPIVVKVGEEMDKVF 159
            .                :.|:|| :|.| .|||.|..|.:|       :...|::...|::|   
  Rat   118 QFLAPWIVSGTGYGLLLLNGKKWFQHWR-MLTPAFHYGILKPYVKIMADSVSIMLDKWEKLD--- 178

  Fly   160 RSKTAADRGQVLEVVDLVARYTADVIGNCAFG------LNCNSLYDPKA--EFVSIGKRAITEHR 216
                  |:...||:...|:..|.|.:..|||.      |:.||....||  :..::....:....
  Rat   179 ------DQDHPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLTFFRVRSAF 237

  Fly   217 YGNMLDIFLFGFPKLSRR------------LRL-KLNIQEAEDFYTKIVRETIDYRLRTKEKRN- 267
            |||.:...:....:||||            ::: |..:|..|:..            :.::||: 
  Rat   238 YGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEEELQ------------KARKKRHL 290

  Fly   268 DFMDSLIEMYKNEQSGNSEDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKL 330
            ||:|.|:       ....|||  |:..:|.|:...|...|.:|:::.:.:..|.||.:.:.|::.
  Rat   291 DFLDILL-------FAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERC 348

  Fly   331 REEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTI 395
            |||:.::.| .....|::.:.::.|....:.|.||.||.:..::|...:..:..|.: .|.||..
  Rat   349 REEVQSILG-DGTSVTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGR-SIPKGIT 411

  Fly   396 VVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAY 460
            ..|...|:|::|..:|.|::|.|.||:.:  :.|.|..:|||..|.|||||.:|.|.:..|.:|.
  Rat   412 TTILIYGLHHNPSYWPNPKVFDPSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELKVAVAL 474

  Fly   461 LIRGYKFSVSPE-TQIPMKIVVKNILISAENGIHLKVEKL 499
            .:  .:|.:.|: |:||  :.:..:::.::|||||:::||
  Rat   475 TL--LRFELLPDPTRIP--VPMARLVLKSKNGIHLRLKKL 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 120/501 (24%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 119/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.