DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:418 Identity:112/418 - (26%)
Similarity:203/418 - (48%) Gaps:41/418 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSK--TAAD 166
            |||..:...|...|....|.||...||.|||.|..    |:....||:..:...:..:|  ..|.
  Rat   123 VFYRFLKPWLGDGLLLSTGDKWSRHRHMLTPAFHF----NILKPYVKIFNDSTNIMHAKWQRLAS 183

  Fly   167 RGQV-LEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAITEHRYGNMLDIFLFGF 228
            :|.. |::.:.::..|.|.:..|.|..:.|....| :|:::  :...|:...|:.::| :::..|
  Rat   184 QGSARLDMFEHISLMTLDSLQKCVFSFDSNCQEKP-SEYITAILELSALVARRHQSLL-LYVDLF 246

  Fly   229 PKLSR-RLRLKLNIQEAEDFYTKIVRETIDYRLRT--------------KEKRNDFMDSLIEMYK 278
            ..|:| .:|.:...:...||...::||    |.||              |.|..||:|.|: :.|
  Rat   247 YHLTRDGMRFRKACRLVHDFTDAVIRE----RRRTLPDQGGDDALKAKAKAKTLDFIDVLL-LSK 306

  Fly   279 NEQSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHN 342
            :|..    :.|:..::.|:|..|...|.:|:::.:.:.||.||::.:.|::.|:|:..:. .:..
  Rat   307 DEHG----EALSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERCRQEVRELLRDREP 367

  Fly   343 KEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDP 407
            :|..::.:.::.:|...:.|:||.:|....::|....|....|.: .|.||.|..|...|.|::|
  Rat   368 EEIEWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGR-VIPKGVICRISIFGTHHNP 431

  Fly   408 DIYPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPE 472
            .::|:||::.|.||..:....|....::||..|||||||..|.|.:..|.||..:  .:|.|.|:
  Rat   432 AVWPDPEVYNPFRFDADNGEGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTL--LRFRVLPD 494

  Fly   473 TQIPMKIVVKNILISAENGIHLKVEKLA 500
            .:.|.:  ...:::.||.|:.|:||.|:
  Rat   495 DKEPRR--KPELILRAEGGLWLRVEPLS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 105/394 (27%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 108/411 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.