DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4A22

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:544 Identity:137/544 - (25%)
Similarity:240/544 - (44%) Gaps:97/544 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAAR-RRHGYWQRRGI---PHDEVHPLFGNIKDWPNKRHIAEIFRDYYFK 61
            :|.:..::::|.||:.||: ..|..|..:.:   |....|.|||:|:::.:.:.:..|      :
Human    18 ILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRI------Q 76

  Fly    62 YKNSDYPFAGFFFFFTRTAVVT--DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQK 124
            .:...:|.|..::.:.....|.  |.:.:|.:|.:  :..::.| .|..:...:...|..:.||.
Human    77 ERVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGR--SDPKSHG-SYKFLAPRIGYGLLLLNGQT 138

  Fly   125 WRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQ--VLEVVDLVARYTADVIGN 187
            |...|..|||.|.:..:|   |.|..:.:.: :|...|.....||  .|||...|:..|.|.|..
Human   139 WFQHRRMLTPAFHNDILK---PYVGLMADSV-RVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMK 199

  Fly   188 CAFG------------------LNCNSLY-----------DPKAEFVSIGK---RAI-TEHRYGN 219
            .||.                  .:.|||.           |......|.|:   ||. ..|::.:
Human   200 SAFSHQGSIQVDRNSQSYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTD 264

  Fly   220 MLDIFLFGFPKLSRRLRLKLNIQEAEDFYTKIVRETIDYRLRTKEKRN-DFMDSLIEMYKNEQSG 283
            .:             ::|:....:.|....||           |.||: ||:|.|:       ..
Human   265 QV-------------IQLRKAQLQKEGELEKI-----------KRKRHLDFLDILL-------LA 298

  Fly   284 NSEDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFT 346
            ..|:|  |:..:|.|:...|...|.:|:::.:.:.||.||.:...|::.||||..:.| .....|
Human   299 KMENGSILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLG-DGASIT 362

  Fly   347 YEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYP 411
            :..:.:|.|....:.|.||.||.:..:.|...|..:..|.: .:.||.:|::...|:|::|.::|
Human   363 WNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWP 426

  Fly   412 EPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPE-TQI 475
            ..|:|.|.||...  :|:.|..:|||..|.|||||.:|.|.|..|..|..:  .:|.:.|: |:|
Human   427 NLEVFDPSRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTL--LRFELLPDPTRI 487

  Fly   476 PMKIVVKNILISAENGIHLKVEKL 499
            |  |.:..:::.::|||||::.:|
Human   488 P--IPMARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 121/482 (25%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 127/504 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.