DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4X1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:527 Identity:139/527 - (26%)
Similarity:238/527 - (45%) Gaps:65/527 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGN---IKDWPNKRHIAEIFRDYYFKYKN 64
            :..|.:.:|..:....||:......|..|....|...|:   |:| .|...:.||...|...:..
Human    19 VFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQD-DNMEKLEEIIEKYPRAFPF 82

  Fly    65 SDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDP-LSATLFSIEGQKWRHL 128
            ...||..||..:       |.:..|.:|    :..:.:..:..:...| |...|.:::|.||...
Human    83 WIGPFQAFFCIY-------DPDYAKTLL----SRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQH 136

  Fly   129 RHKLTPTFTSGKMKNMFPIVV-KVGEEMDKVFRSKTAADRGQVLEVVDLVARYTADVIGNCAFG- 191
            |..|||.|....:|....::. .|...:||  ..|..:.:...:||.:.:...:.|:|..|||. 
Human   137 RRLLTPGFHFNILKAYIEVMAHSVKMMLDK--WEKICSTQDTSVEVYEHINSMSLDIIMKCAFSK 199

  Fly   192 -LNC--NSLYDPKAEFV-SIGKRAITEHRYGNML---DIFL------FGFPKLSRRLRLKLN--I 241
             .||  ||.:||.|:.: .:.|  |..||..::|   ||..      :.|.||||.|....:  |
Human   200 ETNCQTNSTHDPYAKAIFELSK--IIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTII 262

  Fly   242 QEAEDFYTKIVRETIDYRLRTKEKRNDFMDSLIEMYKNEQSGNSEDGLTFNEL--LAQAFIFFVA 304
            ||.:    |.::..:......|.|..||:|.::       |...|.|.:|:::  .::...|.:|
Human   263 QERK----KSLQAGVKQDNTPKRKYQDFLDIVL-------SAKDESGSSFSDIDVHSEVSTFLLA 316

  Fly   305 GFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYLEQVVMETLRKYPV 369
            |.:|.:.::.:.||.||.|.:.|::.|||:..:.| .....|::.:.||.|....:.||.|..|.
Human   317 GHDTLAASISWILYCLALNPEHQERCREEVRGILG-DGSSITWDQLGEMSYTTMCIKETCRLIPA 380

  Fly   370 LAHLTRMTDTDFSPEDPKYF-----IAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAAR 429
            :..::|    |.|  .|..|     :..|..||:...|:|::|.::..|::|.|.||:.|....|
Human   381 VPSISR----DLS--KPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQR 439

  Fly   430 PSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILISAENGIHL 494
            ....:|||..|.|||||..|.|::..|.:|.::  ..|.|:|:...|:.. ..:.::..:||::|
Human   440 HPYAYLPFSAGSRNCIGQEFAMIELKVTIALIL--LHFRVTPDPTRPLTF-PNHFILKPKNGMYL 501

  Fly   495 KVEKLAK 501
            .::||::
Human   502 HLKKLSE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 128/469 (27%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 131/490 (27%)
heme binding region 447..460 7/12 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.