DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and erg5

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_593788.2 Gene:erg5 / 2542469 PomBaseID:SPAC19A8.04 Length:543 Species:Schizosaccharomyces pombe


Alignment Length:500 Identity:106/500 - (21%)
Similarity:195/500 - (39%) Gaps:74/500 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVFAARRRHGYWQRRG-IPHDEVH-PLFGNIKDWPNKRHIAEIFRDYYFKYKNSDYPFAGFFFF 75
            |.|..|..:..|..::| ||..... |..|:..|     .:...|..|..|::..  |.:....|
pombe    36 LAVCIAYDQISYQMQKGHIPGPRFKIPFMGSFLD-----SMKPTFEKYNAKWQTG--PLSCVSVF 93

  Fly    76 FTRTAVVTDMELLKRVL--------------IKDFNHFENRGVFYNEIDDPLSATLFSIEGQKWR 126
            .....:.::.:|.:::|              .|...|  ...||              ::|:...
pombe    94 HKFVVIASERDLARKILNSPSYVQPCVVDAGKKILKH--TNWVF--------------LDGRDHI 142

  Fly   127 HLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQ-VLEVVDLVARYTADVIGNCAF 190
            ..|..|...||:..:.:..|....|..:..|.|.:.:..|..| ::...|:....:....  |.:
pombe   143 EYRKGLNGLFTTRALASYLPAQEAVYNKYFKEFLAHSKDDYAQYMIPFRDINVATSCRTF--CGY 205

  Fly   191 GLNCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLNIQEAEDFYTKIVRET 255
            .::.:::.....|:..|  .|..|          |..||.:....::...||..:......::..
pombe   206 YISDDAIKHIADEYWKI--TAAME----------LVNFPIVLPFTKVWYGIQSRKVVMRYFMKAA 258

  Fly   256 IDYRLRTKEKRN-------DFMDSLIE--MYKNEQSGNSEDGLTF-----NELLAQAFI-FFVAG 305
            .:.| :..|..|       :::..:||  .||:|....:|.....     :|.::..|: |..|.
pombe   259 AESR-KNMEAGNAPACMMEEWIHEMIETRKYKSENKEGAEKPSVLIREFSDEEISLTFLSFLFAS 322

  Fly   306 FETSSTTMGFALYELARNQDVQDKLREEIGNV-FGKHNKEFTYEGIKEMKYLEQVVMETLRKYPV 369
            .:.:|:.|.:....||.:.||..|:|||...: .|..:...:.:.:::|.|...||.|.||..|.
pombe   323 QDATSSAMTWLFQLLADHPDVLQKVREEQLRIRKGDIDVPLSLDLMEKMTYTRAVVKECLRLRPP 387

  Fly   370 LAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERFTDEEIAARPSCTW 434
            :..:.......| |..|.|.:.|..:|:....|..:|..:|||||.|.|:|:....:|.:....|
pombe   388 VLMVPYRVKKAF-PITPDYTVPKDAMVIPTLYGALHDSKVYPEPETFNPDRWAPNGLAEQSPKNW 451

  Fly   435 LPFGEGPRNCIGLRFGM--MQTCVGLAYLIRGYKFSVSPETQIPM 477
            :.||.||..|:|.|:.:  :..|:|.|.::..:|...:|::...|
pombe   452 MVFGNGPHVCLGQRYAVNHLIACIGKASIMLDWKHKRTPDSDTQM 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 98/475 (21%)
erg5NP_593788.2 CypX 57..505 CDD:225035 98/478 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.