DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:534 Identity:134/534 - (25%)
Similarity:234/534 - (43%) Gaps:82/534 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLALIVVILSLLVFAARRRHGYWQRRGIPHDEVHPLFGNIKDWPNKRHIAEIFR----DYYFKYK 63
            ::.|:|::|.|.....||:.........|....|.|||         |..||.:    |....:.
  Rat    19 VVILMVIVLKLFSLLLRRQKLARAMDSFPGPPTHWLFG---------HALEIQKLGSLDKVVSWA 74

  Fly    64 NSDYPFAGFFFF--FTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFS------- 119
             ..:|.|...:|  |.....:.:.:..|.|.        :||       ||.:|.::.       
  Rat    75 -QQFPHAHPLWFGQFVGFLNIYEPDYAKAVY--------SRG-------DPKAADVYDFFLQWIG 123

  Fly   120 -----IEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEE----MDKVFRSKTAADRGQVLEVVD 175
                 ::|.||...|..|||.|....:|   |.|....|.    :|| :..|  |...:..::..
  Rat   124 KGLLVLDGPKWFQHRKLLTPGFHYDVLK---PYVAIFAESTRMMLDK-WEKK--ASENKSFDIFC 182

  Fly   176 LVARYTADVIGNCAFGL-------NCNSLYDPKAEFVSIGKRAITEHRYGNMLDIFLFGFPKLSR 233
            .|.....|.:..|.||.       ..||.|...::...:.::.|...:|.|   .|::......|
  Rat   183 DVGHMALDTLMKCTFGKGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHN---DFIYWLTPHGR 244

  Fly   234 RLRLKLNIQEAEDFYTKIVRE----TIDYRLRTK--EKRN-DFMDSLIEMYKNEQSGNSEDGLTF 291
            |......|  |.|...:::|:    ..|.:.|.|  ::|: ||:|.|:.:  .::||..   |:.
  Rat   245 RFLRACKI--AHDHTDEVIRQRKAALQDEKERKKIQQRRHLDFLDILLGV--RDESGIK---LSD 302

  Fly   292 NELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKEMKYL 356
            .||.|:...|...|.:|:::.:.:.||.:|...:.|...|||:..:.|..: .|.::.:.:|.||
  Rat   303 AELRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQD-SFQWDDLAKMTYL 366

  Fly   357 EQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFKPERF 421
            ...:.|..|.||.:..:.|..:...:..|.:...| |:::.:....:|.:..::|:||:|.|.||
  Rat   367 TMCMKECFRLYPPVPQVYRQLNKPVTFVDGRSLPA-GSLISLHIYALHRNSTVWPDPEVFDPLRF 430

  Fly   422 TDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIPMKIVVKNILI 486
            :.|..|.|....::||..|||||||.:|.|.:..|..|..:..::||:.| :::|:|  |..:::
  Rat   431 SPENAAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDP-SKMPIK--VPQLIL 492

  Fly   487 SAENGIHLKVEKLA 500
            .::|||||.::.||
  Rat   493 RSKNGIHLYLKPLA 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 118/477 (25%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 124/498 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.