DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:244 Identity:62/244 - (25%)
Similarity:104/244 - (42%) Gaps:48/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRR---GIPHDEVHPLFGNIK---------------DWPN 47
            ::|.:::|.::|.:::....|...::.|   |:...|.|.|.||:|               ||.|
 Worm     4 LILTSILVSLVSFIIYVILARKERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYN 68

  Fly    48 KRH--IAEIFRDYYFKYKNSDYPFAGFFFFFTRTAVVTDMELLKRVLIKDFNHFENRG----VFY 106
            |.|  ..|.|               |.:|.......:|:.|.:|.|.||:|::|.:|.    :..
 Worm    69 KLHKQFGETF---------------GIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIED 118

  Fly   107 NEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVL 171
            |::.:.|....:.   ..|:|.|..:.|.|::||||.|...:....:...::.:.|  |..||..
 Worm   119 NKLKESLLQNTYE---SGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEK--ASSGQKW 178

  Fly   172 EVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRAIT----EHR 216
            ::.|.....|.||||.|||.::.|...|....|....::.||    .||
 Worm   179 DIYDDFQGLTLDVIGKCAFAIDSNCQRDRNDIFYVNARKFITNIDIRHR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 55/206 (27%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 52/197 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.