DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4A11

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_000769.2 Gene:CYP4A11 / 1579 HGNCID:2642 Length:519 Species:Homo sapiens


Alignment Length:538 Identity:134/538 - (24%)
Similarity:244/538 - (45%) Gaps:85/538 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLLALIVVILSLLVFAAR-RRHGYWQRRGI---PHDEVHPLFGNIKDWPNKRHIAEIFRDYYFK 61
            :|..|.::::|.||:.|.: ..|..|..:.:   |....|.|||:|::....:.:..|     .|
Human    18 ILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRI-----QK 77

  Fly    62 YKNSDYPFAGFFFFFTRTAVVT--DMELLKRVLIKDFNHFENRGVFYNEIDDPLSATLFSIEGQK 124
            :..: :|.|...:.:.....|.  |.:.:|.:|.:  :..::.| .|..:...:...|..:.||.
Human    78 WVET-FPSACPHWLWGGKVRVQLYDPDYMKVILGR--SDPKSHG-SYRFLAPWIGYGLLLLNGQT 138

  Fly   125 WRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQ--VLEVVDLVARYTADVIGN 187
            |...|..|||.|....:|   |.|..:.:.: :|...|.....||  .|||...|:..|.|.|..
Human   139 WFQHRRMLTPAFHYDILK---PYVGLMADSV-RVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMK 199

  Fly   188 CAFGLNCNSLYDPKAE-FVSIGKRAITEHRYGNMLDIFLFGFPKLSRRLRLKLNIQEAEDFYT-- 249
            |||....:...|..:: ::    :||::      |:..:|.        |::....:.:..|:  
Human   200 CAFSHQGSIQVDRNSQSYI----QAISD------LNNLVFS--------RVRNAFHQNDTIYSLT 246

  Fly   250 ----------KIVRETIDYRL--------------RTKEKRN-DFMDSLIEMYKNEQSGNSEDG- 288
                      ::..:..|..:              :.|.||: ||:|.|:       ....|:| 
Human   247 SAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILL-------LAKMENGS 304

  Fly   289 -LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEGIKE 352
             |:..:|.|:...|...|.:|:::.:.:.||.||.:...|::.||||.::.| .....|:..:.:
Human   305 ILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHSLLG-DGASITWNHLDQ 368

  Fly   353 MKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEIFK 417
            |.|....:.|.||.||.:..:.|...|..:..|.: .:.||.:|::...|:|::|.::|.||:|.
Human   369 MPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNPEVFD 432

  Fly   418 PERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPE-TQIPMKIVV 481
            |.||...  :|:.|..:|||..|.|||||.:|.|.:..|..|..:  .:|.:.|: |:||  |.:
Human   433 PFRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNELKVATALTL--LRFELLPDPTRIP--IPI 491

  Fly   482 KNILISAENGIHLKVEKL 499
            ..:::.::|||||::.:|
Human   492 ARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 118/476 (25%)
CYP4A11NP_000769.2 p450 52..505 CDD:278495 124/498 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.