DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4F22

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_775754.2 Gene:CYP4F22 / 126410 HGNCID:26820 Length:531 Species:Homo sapiens


Alignment Length:413 Identity:110/413 - (26%)
Similarity:198/413 - (47%) Gaps:33/413 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRG 168
            :||..:...|...|...:|.||...|..|||.|....:|....|..:..:.|...:| ..|....
Human   131 LFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWR-HLAEGSA 194

  Fly   169 QVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--IGKRAIT---EHRYGNMLDIFLFGF 228
            ..|::.:.::..|.|.:..|.|..|.| ..:..::::|  |...|::   ::|..:.|| |::..
Human   195 VSLDMFEHISLMTLDSLQKCVFSYNSN-CQEKMSDYISAIIELSALSVRRQYRLHHYLD-FIYYR 257

  Fly   229 PKLSRRLRLKLNIQEAEDFYTKIVRET--------IDYRLRTKE-KRNDFMDSLIEMYKNEQSGN 284
            ....||.|...::  ...|.|::::|.        .:..|:.|: |..||:|.|:       ...
Human   258 SADGRRFRQACDM--VHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLL-------LAR 313

  Fly   285 SEDG--LTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKEFT 346
            .|||  |:..::.|:|..|...|.:|:|:.:.:.|:.||:..:.|:|.||||..|. |:..:|..
Human   314 DEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELE 378

  Fly   347 YEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYP 411
            ::.:.::.:....:.|:||:||.:..::|....|....|.: .|.||.|.::...|.|::|.::|
Human   379 WDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGR-IIPKGIICLVSIYGTHHNPTVWP 442

  Fly   412 EPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQIP 476
            :.:::.|.||..:....|....::||..|||||||..|.|.:..|.:|..:..::.||....::.
Human   443 DSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVR 507

  Fly   477 MKIVVKNILISAENGIHLKVEKL 499
            .|   ..:::..|||:.||||.|
Human   508 RK---PELILRTENGLWLKVEPL 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 101/390 (26%)
CYP4F22NP_775754.2 p450 60..524 CDD:278495 106/408 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.