DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a17 and CYP4F8

DIOPT Version :9

Sequence 1:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens


Alignment Length:415 Identity:113/415 - (27%)
Similarity:194/415 - (46%) Gaps:37/415 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRG 168
            |||..:...|...|....|.||||.|..|||.|....:|....|..|....|...:: :.|.:..
Human   123 VFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQ-RLAMEGS 186

  Fly   169 QVLEVVDLVARYTADVIGNCAFGLNCNSLYDPKAEFVS--------IGKRAITEHRYGNMLDIFL 225
            ..|:|.:.::..|.|.:..|.|..:.|....| :|:::        :.||.....||.:    ||
Human   187 TCLDVFEHISLMTLDSLQKCIFSFDSNCQEKP-SEYITAIMELSALVVKRNNQFFRYKD----FL 246

  Fly   226 FGFPKLSRRLRLKLNIQEAEDFYTKIVRET--------ID--YRLRTKEKRNDFMDSLIEMYKNE 280
            :......||......:  ..||...:::|.        :|  .:.:.|.|..||:|.|:   .:|
Human   247 YFLTPCGRRFHRACRL--VHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLL---LSE 306

  Fly   281 QSGNSEDGLTFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVF-GKHNKE 344
            .....|  |:..::.|:|..|...|.:|:::.:.:.||.|||:.:.|::.|:|:..:. .:..||
Human   307 DKNGKE--LSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKE 369

  Fly   345 FTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDI 409
            ..::.:.::.:|...:.|:||.:|.:....|....|....|.: .|.||.:..|....||::|.:
Human   370 IEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSR-VIPKGNVCNINIFAIHHNPSV 433

  Fly   410 YPEPEIFKPERFTDEEIAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSPETQ 474
            :|:||::.|.||..|....|....::||..|||||||.:|.|.:..|.||..:  .:|.:.|:.:
Human   434 WPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTL--LRFRILPDHR 496

  Fly   475 IPMKIVVKNILISAENGIHLKVEKL 499
            .|.:  ...|::.||:|:.|:||.|
Human   497 EPRR--TPEIVLRAEDGLWLRVEPL 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 105/392 (27%)
CYP4F8NP_009184.1 p450 52..504 CDD:306555 105/398 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.