DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eif4e3

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001016049.1 Gene:eif4e3 / 548803 XenbaseID:XB-GENE-992071 Length:218 Species:Xenopus tropicalis


Alignment Length:232 Identity:62/232 - (26%)
Similarity:109/232 - (46%) Gaps:41/232 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AAPAEAKDVKPKEDPQ------ETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLEND 95
            ||||:.: ::|:.|.|      |.||.|       .|...|   ||.:   ||.:.||.|.   |
 Frog     5 AAPADRR-LQPEPDEQLHLNHRELGELA-------LPQEPD---TEGI---PLHSPWTFWL---D 52

  Fly    96 RS------KSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQG 154
            ||      ...|....:|.:..|::.|||:||:|...:.:.|...|.|.:...:|:||:.:|.:|
 Frog    53 RSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPQVTNLPLRWSYHLMRGERKPLWEEESNAKG 117

  Fly   155 GRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDH----SDQICGAVINIRGKSNKISIWTADGN-- 213
            |.|.:.:.|.:.:   .:|.::||..|||.|..    .|::.|..:::|.:.:.:.:|..:.:  
 Frog   118 GVWKMKVPKEASS---LVWKELLLATIGEQFTDRCAPEDEVIGVSVSVRDREDVVQVWNGNASVV 179

  Fly   214 NEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQG 250
            .|...||   |:.:.|......::.|:.|::....:|
 Frog   180 GEATVLE---KIYELLPNTSFKAVFYKPHEEHHAFEG 213

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 44/168 (26%)
eif4e3NP_001016049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 6/15 (40%)
IF4E 45..198 CDD:279921 42/161 (26%)