DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eif4e

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001015909.1 Gene:eif4e / 548663 XenbaseID:XB-GENE-855435 Length:214 Species:Xenopus tropicalis


Alignment Length:218 Identity:102/218 - (46%)
Similarity:137/218 - (62%) Gaps:10/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VKPK-EDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEIT 108
            |:|: .:||.|.|....|:       .:.|..:...||||.|.|.||:.:||:||:|:.....|:
 Frog     4 VEPEGTNPQSTEEEKTETS-------QEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLIS 61

  Fly   109 SFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSS-KTDLDNL 172
            .||||||||:|||||:..|.:..|.||||||..|.|||||..||:||||:|||||.. :.|||..
 Frog    62 KFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRF 126

  Fly   173 WLDVLLCLIGEAFD-HSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNS 236
            ||:.|:|||||:|| :||.:||||:|:|.|.:||:|||.:..|.:|...||...::.|.|.....
 Frog   127 WLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVV 191

  Fly   237 LQYQLHKDTMVKQGSNVKSIYTL 259
            :.||.|.||..|.||..|:.:.:
 Frog   192 IGYQSHADTATKSGSTTKNRFVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 83/158 (53%)
eif4eNP_001015909.1 IF4E 38..194 CDD:279921 81/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.