DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eif4e2

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:211 Identity:71/211 - (33%)
Similarity:111/211 - (52%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PKEDPQETGEPAGNTATTT-----AP-AGDDAVRTEHLYKHPLMNVWTLWYLEND-----RSKSW 100
            ||:..:|..:.....|.||     .| ||:          |||...:|.||....     .::|:
Zfish    23 PKDGEKEKNDEEDKEANTTKRKAVVPGAGE----------HPLQYNYTFWYSRRTPGRPASTQSY 77

  Fly   101 EDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSS 165
            |....:|.||.:||.||..|:|:..|.::...||:.|||:.|:|||||.|||.||:|:|.|.|..
Zfish    78 EQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIRLRKGL 142

  Fly   166 KTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALR 230
            .:   ..|.:::|.::||.|...::|||||:::|.:.:.||||....:::.....|...||..|.
Zfish   143 AS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLN 204

  Fly   231 LGRNNSLQYQLHKDTM 246
            |..|..::|:.|.|::
Zfish   205 LPPNTIMEYKTHTDSI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 58/161 (36%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 58/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.