DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eif4eb

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:226 Identity:108/226 - (47%)
Similarity:139/226 - (61%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSW 100
            |.|..|.|....|.:.:.:.|           :..:.|..|...||||.|.|.||:.:||:||:|
Zfish     2 ATAEPEIKSNSCKSEEEISDE-----------SNQEIVSPESYIKHPLQNRWCLWFFKNDKSKTW 55

  Fly   101 EDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSS 165
            :.....|:.||||||||:|||||:..|.:..|.||||||..|.|||||..||:||||:|||||..
Zfish    56 QANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQQ 120

  Fly   166 -KTDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDA 228
             |.|||..||:.||||||||| |:||.:||||:|:|.|.:||:|||||..|.||...||...::.
Zfish   121 RKYDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAIWTADYGNREAVTHIGRVYKER 185

  Fly   229 LRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259
            |.:..|.::.||.|.||..|.||..|:.:.:
Zfish   186 LGVPMNMTIGYQSHADTATKSGSTTKNKFVV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 89/158 (56%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 87/155 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573561
Domainoid 1 1.000 193 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 216 1.000 Inparanoid score I3585
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.