DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eIF4E6

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster


Alignment Length:137 Identity:83/137 - (60%)
Similarity:96/137 - (70%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRP 144
            ||.|.|.||||.::.|...|||||..||.||:||||||:||..|..||::..|.||.||||.|||
  Fly    32 KHRLQNTWTLWGVKYDPEISWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRP 96

  Fly   145 MWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWT 209
            ||||..||.||||...::|.|..:||..|||||||:||||.||.||||||.:.||...||||:||
  Fly    97 MWEDPPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWT 161

  Fly   210 -ADGNNE 215
             ||..:|
  Fly   162 KADAGDE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 81/135 (60%)
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 79/130 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470286
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
109.900

Return to query results.
Submit another query.