DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eif4e2rs1

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_957053.1 Gene:eif4e2rs1 / 393732 ZFINID:ZDB-GENE-040426-1728 Length:228 Species:Danio rerio


Alignment Length:181 Identity:62/181 - (34%)
Similarity:102/181 - (56%) Gaps:9/181 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KHPLMNVWTLWYLENDRSK-----SWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFK 139
            :|||...:|.||.....|:     |:|....::.:..:||.||..|:|:..|.::...||:.|||
Zfish    47 EHPLQYNYTFWYSRRTPSRPANTQSYEQNIRQMGTVASVEQFWKFYSHLVRPGDLTGHSDFHLFK 111

  Fly   140 KNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNK 204
            :.|:|||||.|||.||:|:|.|.|...:   ..|.:::|.::||.|...::|||.|::||.:.:.
Zfish   112 EGIKPMWEDEANKNGGKWIIRLRKGLAS---RFWENIILAMLGEQFMVGEEICGVVVSIRFQEDI 173

  Fly   205 ISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKS 255
            :|||....|::.....|...||..|.|..|..::|:.|.|:: |..|:.::
Zfish   174 LSIWNKTANDQVTTSRIRDTLRRVLNLPPNTIMEYKTHNDSL-KDNSSFRN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 56/161 (35%)
eif4e2rs1NP_957053.1 IF4E 52..208 CDD:279921 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.