DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and eIF4E4

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster


Alignment Length:178 Identity:133/178 - (74%)
Similarity:154/178 - (86%) Gaps:1/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRP 144
            ||||.|.||||||||||||:||||||||||||.||||||||||||.||||::|||||||||.|:|
  Fly    51 KHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQP 115

  Fly   145 MWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCLIGEAFDHSDQICGAVINIRGKSNKISIWT 209
            ||||.|||.||||||.:.:.||.:||.|||||||.||||||::::::||||||:|||||||||||
  Fly   116 MWEDDANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT 180

  Fly   210 ADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIY 257
            |:|:||.|.:|||.||||.|.| ..:.||||||||||.||||.:|::|
  Fly   181 ANGHNELAVMEIGLKLRDLLVL-PPHQLQYQLHKDTMCKQGSVIKAVY 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 116/156 (74%)
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 114/153 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470281
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 1 0.950 - 0 Normalized mean entropy S964
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
1413.780

Return to query results.
Submit another query.