DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E1 and EIF4E

DIOPT Version :9

Sequence 1:NP_001261626.1 Gene:eIF4E1 / 45525 FlyBaseID:FBgn0015218 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:273 Identity:109/273 - (39%)
Similarity:140/273 - (51%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGNTATTTAPAGDDAVRTEHLYKHPLM 84
            |..|.|.. .|.|||:        :.:..|..||...|                  ||..||||.
Human     3 TVEPETTP-TPNPPTT--------EEEKTESNQEVANP------------------EHYIKHPLQ 40

  Fly    85 NVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149
            |.|.||:.:||:||:|:.....|:.||||||||:|||||:..|.:..|.||||||..|.|||||.
Human    41 NRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDE 105

  Fly   150 ANKQGGRWVITLNKSS-KTDLDNLWLDV-------------------------------LLCLIG 182
            .||:||||:|||||.. ::|||..||:.                               ||||||
Human   106 KNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLVSNFWPQVILPLQPPKVLELQLLCLIG 170

  Fly   183 EAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTM 246
            |:| |:||.:||||:|:|.|.:||:|||.:..|.||...||...::.|.|.....:.||.|.||.
Human   171 ESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTA 235

  Fly   247 VKQGSNVKSIYTL 259
            .|.||..|:.:.:
Human   236 TKSGSTTKNRFVV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E1NP_001261626.1 IF4E 82..239 CDD:366742 85/189 (45%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 85/189 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140836
Domainoid 1 1.000 187 1.000 Domainoid score I3336
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 214 1.000 Inparanoid score I3630
Isobase 1 0.950 - 0 Normalized mean entropy S964
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8454
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.